AKR1C4 (NM_001818) Human Tagged ORF Clone

SKU
RC204731
AKR1C4 (Myc-DDK-tagged)-Human aldo-keto reductase family 1, member C4 (chlordecone reductase, 3-alpha hydroxysteroid dehydrogenase, type I, dihydrodiol dehydrogenase 4) (AKR1C4)
  • TrueORF Gold

    Protein expression verified by Western blot, fully sequenced and in stock

    Click here to learn more.

$300.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol AKR1C4
Synonyms 3-alpha-HSD; C11; CDR; CHDR; DD-4; DD4; HAKRA
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC204731 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGATCCCAAATATCAGCGTGTAGAGCTAAATGATGGTCACTTCATGCCCGTATTGGGATTTGGCACCT
ATGCACCTCCAGAGGTTCCGAGGAACAGAGCTGTAGAGGTCACCAAATTAGCAATAGAAGCTGGCTTCCG
CCATATTGATTCTGCTTATTTATACAATAATGAGGAGCAGGTTGGACTGGCCATCCGAAGCAAGATTGCA
GATGGCAGTGTGAAGAGAGAAGACATATTCTACACTTCAAAGCTTTGGTGCACTTTCTTTCAACCACAGA
TGGTCCAACCAGCCTTGGAAAGCTCACTGAAAAAACTTCAACTGGACTATGTTGACCTCTATCTTCTTCA
TTTCCCAATGGCTCTCAAGCCAGGTGAGACGCCACTACCAAAAGATGAAAATGGAAAAGTAATATTCGAC
ACAGTGGATCTCTCTGCCACATGGGAGGTCATGGAGAAGTGTAAGGATGCAGGATTGGCCAAGTCCATCG
GGGTGTCAAACTTCAACTACAGGCAGCTGGAGATGATCCTCAACAAGCCAGGACTCAAGTACAAGCCTGT
CTGCAACCAGGTAGAATGTCATCCTTACCTCAACCAGAGCAAACTGCTGGATTTCTGCAAGTCAAAAGAC
ATTGTTCTGGTTGCCCACAGTGCTCTGGGAACCCAACGACATAAACTATGGGTGGACCCAAACTCCCCAG
TTCTTTTGGAGGACCCAGTTCTTTGTGCCTTAGCAAAGAAACACAAACGAACCCCAGCCCTGATTGCCCT
GCGCTACCAGCTGCAGCGTGGGGTTGTGGTCCTGGCCAAGAGCTACAATGAGCAGCGGATCAGAGAGAAC
ATCCAGGTTTTTGAATTCCAGTTGACATCAGAGGATATGAAAGTTCTAGATGGTCTAAACAGAAATTATC
GATATGTTGTCATGGATTTTCTTATGGACCATCCTGATTATCCATTTTCAGATGAATAT


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC204731 protein sequence
Red=Cloning site Green=Tags(s)

MDPKYQRVELNDGHFMPVLGFGTYAPPEVPRNRAVEVTKLAIEAGFRHIDSAYLYNNEEQVGLAIRSKIA
DGSVKREDIFYTSKLWCTFFQPQMVQPALESSLKKLQLDYVDLYLLHFPMALKPGETPLPKDENGKVIFD
TVDLSATWEVMEKCKDAGLAKSIGVSNFNYRQLEMILNKPGLKYKPVCNQVECHPYLNQSKLLDFCKSKD
IVLVAHSALGTQRHKLWVDPNSPVLLEDPVLCALAKKHKRTPALIALRYQLQRGVVVLAKSYNEQRIREN
IQVFEFQLTSEDMKVLDGLNRNYRYVVMDFLMDHPDYPFSDEY

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_001818
ORF Size 969 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_001818.5
RefSeq Size 1192 bp
RefSeq ORF 972 bp
Locus ID 1109
UniProt ID P17516
Cytogenetics 10p15.1
Protein Families Druggable Genome
Protein Pathways Androgen and estrogen metabolism, C21-Steroid hormone metabolism, Metabolic pathways, Metabolism of xenobiotics by cytochrome P450, Primary bile acid biosynthesis
MW 37.2 kDa
Summary This gene encodes a member of the aldo/keto reductase superfamily, which consists of more than 40 known enzymes and proteins. These enzymes catalyze the conversion of aldehydes and ketones to their corresponding alcohols by utilizing NADH and/or NADPH as cofactors. The enzymes display overlapping but distinct substrate specificity. This enzyme catalyzes the bioreduction of chlordecone, a toxic organochlorine pesticide, to chlordecone alcohol in liver. This gene shares high sequence identity with three other gene members and is clustered with those three genes at chromosome 10p15-p14. [provided by RefSeq, Jul 2008]
Write Your Own Review
You're reviewing:AKR1C4 (NM_001818) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC204731L3 Lenti ORF clone of Human aldo-keto reductase family 1, member C4 (chlordecone reductase; 3-alpha hydroxysteroid dehydrogenase, type I; dihydrodiol dehydrogenase 4) (AKR1C4), Myc-DDK-tagged 10 ug
$600.00
RC204731L4 Lenti ORF clone of Human aldo-keto reductase family 1, member C4 (chlordecone reductase; 3-alpha hydroxysteroid dehydrogenase, type I; dihydrodiol dehydrogenase 4) (AKR1C4), mGFP tagged 10 ug
$600.00
RG204731 AKR1C4 (tGFP-tagged) - Human aldo-keto reductase family 1, member C4 (chlordecone reductase; 3-alpha hydroxysteroid dehydrogenase, type I; dihydrodiol dehydrogenase 4) (AKR1C4) 10 ug
$489.00 MSRP $500.00 MSRP $500.00
SC319841 AKR1C4 (untagged)-Human aldo-keto reductase family 1, member C4 (chlordecone reductase, 3-alpha hydroxysteroid dehydrogenase, type I, dihydrodiol dehydrogenase 4) (AKR1C4) 10 ug
$300.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.