Apolipoprotein M (APOM) (NM_019101) Human Tagged ORF Clone

SKU
RC204679
APOM (Myc-DDK-tagged)-Human apolipoprotein M (APOM)
  • TrueORF Gold

    Protein expression verified by Western blot, fully sequenced and in stock

    Click here to learn more.

$300.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol Apolipoprotein M
Synonyms apo-M; G3a; HSPC336; NG20
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC204679 representing NM_019101
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGTTCCACCAAATTTGGGCAGCTCTGCTCTACTTCTATGGTATTATCCTTAACTCCATCTACCAGTGCC
CTGAGCACAGTCAACTGACAACTCTGGGCGTGGATGGGAAGGAGTTCCCAGAGGTCCACTTGGGCCAGTG
GTACTTTATCGCAGGGGCAGCTCCCACCAAGGAGGAGTTGGCAACTTTTGACCCTGTGGACAACATTGTC
TTCAATATGGCTGCTGGCTCTGCCCCGATGCAGCTCCACCTTCGTGCTACCATCCGCATGAAAGATGGGC
TCTGTGTGCCCCGGAAATGGATCTACCACCTGACTGAAGGGAGCACAGATCTCAGAACTGAAGGCCGCCC
TGACATGAAGACTGAGCTCTTTTCCAGCTCATGCCCAGGTGGAATCATGCTGAATGAGACAGGCCAGGGT
TACCAGCGCTTTCTCCTCTACAATCGCTCACCACATCCTCCCGAAAAGTGTGTGGAGGAATTCAAGTCCC
TGACTTCCTGCCTGGACTCCAAAGCCTTCTTATTGACTCCTAGGAATCAAGAGGCCTGTGAGCTGTCCAA
TAAC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC204679 representing NM_019101
Red=Cloning site Green=Tags(s)

MFHQIWAALLYFYGIILNSIYQCPEHSQLTTLGVDGKEFPEVHLGQWYFIAGAAPTKEELATFDPVDNIV
FNMAAGSAPMQLHLRATIRMKDGLCVPRKWIYHLTEGSTDLRTEGRPDMKTELFSSSCPGGIMLNETGQG
YQRFLLYNRSPHPPEKCVEEFKSLTSCLDSKAFLLTPRNQEACELSNN

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_019101
ORF Size 564 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_019101.3
RefSeq Size 790 bp
RefSeq ORF 567 bp
Locus ID 55937
UniProt ID O95445
Cytogenetics 6p21.33
Protein Families Secreted Protein
MW 21.1 kDa
Summary The protein encoded by this gene is an apolipoprotein and member of the lipocalin protein family. It is found associated with high density lipoproteins and to a lesser extent with low density lipoproteins and triglyceride-rich lipoproteins. The encoded protein is secreted through the plasma membrane but remains membrane-bound, where it is involved in lipid transport. Alternate splicing results in both coding and non-coding variants of this gene. [provided by RefSeq, Jan 2012]
Write Your Own Review
You're reviewing:Apolipoprotein M (APOM) (NM_019101) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC204679L1 Lenti ORF clone of Human apolipoprotein M (APOM), Myc-DDK-tagged 10 ug
$600.00
RC204679L2 Lenti ORF clone of Human apolipoprotein M (APOM), mGFP tagged 10 ug
$600.00
RC204679L3 Lenti ORF clone of Human apolipoprotein M (APOM), Myc-DDK-tagged 10 ug
$600.00
RC204679L4 Lenti ORF clone of Human apolipoprotein M (APOM), mGFP tagged 10 ug
$600.00
RG204679 APOM (tGFP-tagged) - Human apolipoprotein M (APOM) 10 ug
$489.00 MSRP $500.00 MSRP $500.00
SC128075 APOM (untagged)-Human apolipoprotein M (APOM) 10 ug
$300.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.