GSTA3 (NM_000847) Human Tagged ORF Clone

SKU
RC204624
GSTA3 (Myc-DDK-tagged)-Human glutathione S-transferase alpha 3 (GSTA3)
  • TrueORF Gold

    Protein expression verified by Western blot, fully sequenced and in stock

    Click here to learn more.

$450.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol GSTA3
Synonyms GSTA3-3; GTA3
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC204624 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCAGGGAAGCCCAAGCTTCACTACTTCAATGGACGGGGCAGAATGGAGCCCATCCGGTGGCTCTTGG
CTGCAGCTGGAGTGGAGTTTGAAGAGAAATTTATAGGATCTGCAGAAGATTTGGGAAAGTTAAGAAATGA
TGGGAGTTTGATGTTCCAGCAAGTACCAATGGTTGAGATTGATGGGATTAAGTTGGTACAGACCAGAGCC
ATTCTCAACTACATTGCCAGCAAATACAACCTCTACGGGAAAGACATAAAGGAGAGAGCCCTAATTGATA
TGTATACAGAAGGTATGGCAGATTTGAATGAAATGATCCTTCTTCTGCCCTTATGTCGACCTGAGGAAAA
AGATGCCAAGATTGCCTTGATCAAAGAGAAAACAAAAAGTCGCTATTTCCCTGCCTTCGAAAAAGTGTTA
CAGAGCCATGGACAAGACTACCTTGTTGGCAACAAGCTGAGCCGGGCTGACATTAGCCTGGTGGAACTTC
TCTACTATGTGGAAGAGCTTGACTCCAGCCTTATCTCCAACTTCCCTCTGCTGAAGGCCCTGAAAACCAG
AATCAGCAACCTGCCCACGGTGAAGAAGTTTCTACAGCCTGGCAGCCCAAGGAAGCCTCCCGCAGATGCA
AAAGCTTTAGAAGAAGCCAGAAAGATTTTCAGGTTT


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC204624 protein sequence
Red=Cloning site Green=Tags(s)

MAGKPKLHYFNGRGRMEPIRWLLAAAGVEFEEKFIGSAEDLGKLRNDGSLMFQQVPMVEIDGIKLVQTRA
ILNYIASKYNLYGKDIKERALIDMYTEGMADLNEMILLLPLCRPEEKDAKIALIKEKTKSRYFPAFEKVL
QSHGQDYLVGNKLSRADISLVELLYYVEELDSSLISNFPLLKALKTRISNLPTVKKFLQPGSPRKPPADA
KALEEARKIFRF

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_000847
ORF Size 666 bp
OTI Disclaimer Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery.

The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_000847.2
RefSeq Size 915 bp
RefSeq ORF 669 bp
Locus ID 2940
UniProt ID Q16772
Cytogenetics 6p12.2
Protein Pathways Drug metabolism - cytochrome P450, Glutathione metabolism, Metabolism of xenobiotics by cytochrome P450
MW 25.3 kDa
Summary Cytosolic and membrane-bound forms of glutathione S-transferase are encoded by two distinct supergene families. These enzymes are involved in cellular defense against toxic, carcinogenic, and pharmacologically active electrophilic compounds. At present, eight distinct classes of the soluble cytoplasmic mammalian glutathione S-transferases have been identified: alpha, kappa, mu, omega, pi, sigma, theta and zeta. This gene encodes a glutathione S-tranferase belonging to the alpha class genes that are located in a cluster mapped to chromosome 6. Genes of the alpha class are highly related and encode enzymes with glutathione peroxidase activity. However, during evolution, this alpha class gene diverged accumulating mutations in the active site that resulted in differences in substrate specificity and catalytic activity. The enzyme encoded by this gene catalyzes the double bond isomerization of precursors for progesterone and testosterone during the biosynthesis of steroid hormones. An additional transcript variant has been identified, but its full length sequence has not been determined. [provided by RefSeq, Jul 2008]
Write Your Own Review
You're reviewing:GSTA3 (NM_000847) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC204624L1 Lenti ORF clone of Human glutathione S-transferase alpha 3 (GSTA3), Myc-DDK-tagged 10 ug
$750.00
RC204624L2 Lenti ORF clone of Human glutathione S-transferase alpha 3 (GSTA3), mGFP tagged 10 ug
$750.00
RC204624L3 Lenti ORF clone of Human glutathione S-transferase alpha 3 (GSTA3), Myc-DDK-tagged 10 ug
$750.00
RC204624L4 Lenti ORF clone of Human glutathione S-transferase alpha 3 (GSTA3), mGFP tagged 10 ug
$750.00
RG204624 GSTA3 (tGFP-tagged) - Human glutathione S-transferase alpha 3 (GSTA3) 10 ug
$650.00
SC122577 GSTA3 (untagged)-Human glutathione S-transferase alpha 3 (GSTA3) 10 ug
$450.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.