ZMYND19 (NM_138462) Human Tagged ORF Clone

SKU
RC204509
ZMYND19 (Myc-DDK-tagged)-Human zinc finger, MYND-type containing 19 (ZMYND19)
  • TrueORF Gold

    Protein expression verified by Western blot, fully sequenced and in stock

    Click here to learn more.

$300.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol ZMYND19
Synonyms MIZIP
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC204509 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGACCGACTTCAAATTGGGTATCGTGCGGCTCGGCCGGGTGGCCGGGAAGACCAAATACACGCTGATCG
ATGAGCAGGACATCCCGCTGGTGGAGAGCTACTCCTTTGAGGCCCGAATGGAAGTGGATGCAGATGGAAA
TGGTGCTAAGATATTTGCCTATGCCTTTGACAAGAACCGAGGAAGGGGCTCTGGGAGACTCCTTCATGAG
CTGCTGTGGGAGCGGCACCGGGGGGGCGTGGCCCCGGGCTTCCAGGTGGTGCACCTCAACGCTGTGACCG
TGGACAATCGCCTGGACAACCTGCAACTGGTGCCGTGGGGCTGGCGGCCCAAGGCTGAAGAGACCTCCAG
CAAGCAGAGGGAGCAAAGCTTGTATTGGCTTGCAATTCAGCAGCTGCCTACAGACCCTATAGAAGAACAG
TTTCCTGTCCTAAATGTGACCCGGTATTATAATGCCAACGGGGATGTAGTGGAAGAGGAGGAGAACTCTT
GCACCTACTATGAGTGCCACTACCCTCCCTGCACAGTGATTGAGAAGCAGCTCCGGGAGTTCAACATCTG
TGGGCGCTGCCAGGTGGCCCGGTACTGCGGCTCCCAGTGCCAGCAGAAGGACTGGCCTGCCCACAAGAAG
CACTGTCGGGAGAGGAAGCGTCCCTTCCAGCATGAGCTTGAGCCAGAGCGA


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC204509 protein sequence
Red=Cloning site Green=Tags(s)

MTDFKLGIVRLGRVAGKTKYTLIDEQDIPLVESYSFEARMEVDADGNGAKIFAYAFDKNRGRGSGRLLHE
LLWERHRGGVAPGFQVVHLNAVTVDNRLDNLQLVPWGWRPKAEETSSKQREQSLYWLAIQQLPTDPIEEQ
FPVLNVTRYYNANGDVVEEEENSCTYYECHYPPCTVIEKQLREFNICGRCQVARYCGSQCQQKDWPAHKK
HCRERKRPFQHELEPER

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_138462
ORF Size 681 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_138462.3
RefSeq Size 1371 bp
RefSeq ORF 684 bp
Locus ID 116225
UniProt ID Q96E35
Cytogenetics 9q34.3
Domains zf-MYND
Protein Families Druggable Genome
MW 26.4 kDa
Summary ZMYND19 is a MYND zinc finger domain-containing protein that binds to the C terminus of melanin-concentrating hormone receptor-1 (MCHR1; MIM 601751) (Bachner et al., 2002 [PubMed 12208518]), and to the N termini of alpha-tubulin (TUBA1; MIM 191110), and beta-tubulin (TUBB; MIM 191130) (Francke et al., 2005 [PubMed 16039987]).[supplied by OMIM, Mar 2008]
Write Your Own Review
You're reviewing:ZMYND19 (NM_138462) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC204509L3 Lenti ORF clone of Human zinc finger, MYND-type containing 19 (ZMYND19), Myc-DDK-tagged 10 ug
$600.00
RC204509L4 Lenti ORF clone of Human zinc finger, MYND-type containing 19 (ZMYND19), mGFP tagged 10 ug
$600.00
RG204509 ZMYND19 (tGFP-tagged) - Human zinc finger, MYND-type containing 19 (ZMYND19) 10 ug
$489.00 MSRP $500.00 MSRP $500.00
SC111505 ZMYND19 (untagged)-Human zinc finger, MYND-type containing 19 (ZMYND19) 10 ug
$300.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.