IGLL1 (NM_020070) Human Tagged ORF Clone

SKU
RC204494
IGLL1 (Myc-DDK-tagged)-Human immunoglobulin lambda-like polypeptide 1 (IGLL1), transcript variant 1
  • TrueORF®
    TrueORF®

    Expression-ready ORF plasmid with C-terminal tag(s)

    Click here to learn more.

$289.00 MSRP $300.00 MSRP $300.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol IGLL1
Synonyms 14.1; AGM2; CD179b; IGL1; IGL5; IGLJ14.1; IGLL; IGO; IGVPB; VPREB2
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC204494 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGAGGCCAGGGACAGGCCAGGGGGGCCTTGAGGCCCCTGGTGAGCCAGGCCCCAACCTCAGGCAGCGCT
GGCCCCTGCTGCTGCTGGGTCTGGCCGTGGTAACCCATGGCCTGCTGCGCCCAACAGCTGCATCGCAGAG
CAGGGCCCTGGGCCCTGGAGCCCCTGGAGGAAGCAGCCGGTCCAGCCTGAGGAGCCGGTGGGGCAGGTTC
CTGCTCCAGCGCGGCTCCTGGACTGGCCCCAGGTGCTGGCCCCGGGGGTTTCAATCCAAGCATAACTCAG
TGACGCATGTGTTTGGCAGCGGGACCCAGCTCACCGTTTTAAGTCAGCCCAAGGCCACCCCCTCGGTCAC
TCTGTTCCCGCCGTCCTCTGAGGAGCTCCAAGCCAACAAGGCTACACTGGTGTGTCTCATGAATGACTTT
TATCCGGGAATCTTGACGGTGACCTGGAAGGCAGATGGTACCCCCATCACCCAGGGCGTGGAGATGACCA
CGCCCTCCAAACAGAGCAACAACAAGTACGCGGCCAGCAGCTACCTGAGCCTGACGCCCGAGCAGTGGAG
GTCCCGCAGAAGCTACAGCTGCCAGGTCATGCACGAAGGGAGCACCGTGGAGAAGACGGTGGCCCCTGCA
GAATGTTCA


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC204494 protein sequence
Red=Cloning site Green=Tags(s)

MRPGTGQGGLEAPGEPGPNLRQRWPLLLLGLAVVTHGLLRPTAASQSRALGPGAPGGSSRSSLRSRWGRF
LLQRGSWTGPRCWPRGFQSKHNSVTHVFGSGTQLTVLSQPKATPSVTLFPPSSEELQANKATLVCLMNDF
YPGILTVTWKADGTPITQGVEMTTPSKQSNNKYAASSYLSLTPEQWRSRRSYSCQVMHEGSTVEKTVAPA
ECS

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_020070
ORF Size 639 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_020070.4
RefSeq Size 915 bp
RefSeq ORF 642 bp
Locus ID 3543
UniProt ID P15814
Cytogenetics 22q11.23
Domains ig, IGc1
Protein Families Secreted Protein
Protein Pathways Primary immunodeficiency
MW 23 kDa
Summary The preB cell receptor is found on the surface of proB and preB cells, where it is involved in transduction of signals for cellular proliferation, differentiation from the proB cell to the preB cell stage, allelic exclusion at the Ig heavy chain gene locus, and promotion of Ig light chain gene rearrangements. The preB cell receptor is composed of a membrane-bound Ig mu heavy chain in association with a heterodimeric surrogate light chain. This gene encodes one of the surrogate light chain subunits and is a member of the immunoglobulin gene superfamily. This gene does not undergo rearrangement. Mutations in this gene can result in B cell deficiency and agammaglobulinemia, an autosomal recessive disease in which few or no gamma globulins or antibodies are made. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2008]
Write Your Own Review
You're reviewing:IGLL1 (NM_020070) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC204494L1 Lenti ORF clone of Human immunoglobulin lambda-like polypeptide 1 (IGLL1), transcript variant 1, Myc-DDK-tagged 10 ug
$600.00
RC204494L2 Lenti ORF clone of Human immunoglobulin lambda-like polypeptide 1 (IGLL1), transcript variant 1, mGFP tagged 10 ug
$600.00
RC204494L3 Lenti ORF clone of Human immunoglobulin lambda-like polypeptide 1 (IGLL1), transcript variant 1, Myc-DDK-tagged 10 ug
$600.00
RC204494L4 Lenti ORF clone of Human immunoglobulin lambda-like polypeptide 1 (IGLL1), transcript variant 1, mGFP tagged 10 ug
$600.00
RG204494 IGLL1 (tGFP-tagged) - Human immunoglobulin lambda-like polypeptide 1 (IGLL1), transcript variant 1 10 ug
$489.00 MSRP $500.00 MSRP $500.00
SC111642 IGLL1 (untagged)-Human immunoglobulin lambda-like polypeptide 1 (IGLL1), transcript variant 1 10 ug
$300.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.