GDPD2 (NM_017711) Human Tagged ORF Clone

CAT#: RC204415

Reviews ()
Write a review

GDPD2 (Myc-DDK-tagged)-Human glycerophosphodiester phosphodiesterase domain containing 2 (GDPD2), transcript variant 2

  View "NM_017711" in other vectors (6)

Reward yourself with an Amazon® Card when get any 3 cDNA clones.

USD 410.00


Availability*
In Stock

Size
    • 10 ug


Product images

Specifications

Product Data
Product Name GDPD2 (NM_017711) Human Tagged ORF Clone
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol GDPD2
Synonyms GDE3; OBDPF
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Cell Selection Neomycin
Sequence Data
>RC204415 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCCGAGTCCCCCGGCTGCTGCTCCGTCTGGGCCCGCTGCCTCCACTGCCTGTATAGCTGCCACTGGA
GGAAATGCCCCAGAGAGAGGATGCAAACCAGCAAGTGCGACTGTATCTGGTTTGGCCTGCTCTTCCTCAC
CTTCCTCCTTTCCCTGAGCTGGCTGTACATCGGGCTCGTCCTTCTCAATGACCTGCACAACTTCAATGAA
TTCCTCTTCCGCCGCTGGGGACACTGGATGGACTGGTCCCTGGCATTCCTGCTGGTCATCTCTCTACTGG
TCACATATGCATCCTTGCTATTGGTCCTGGCCCTGCTCCTGCGGCTTTGTAGACAGCCCCTGCATCTGCA
CAGCCTCCACAAGGTGCTGCTGCTCCTCATTATGCTGCTTGTGGCGGCTGGCCTTGTGGGACTGGACATC
CAATGGCAGCAGGAGTGGCATAGCTTGCGTGTGTCACTGCAGGCCACAGCCCCATTCCTTCATATTGGAG
CAGCCGCTGGAATTGCCCTCCTGGCCTGGCCTGTGGCTGATACCTTCTACCGTATCCACCGAAGAGGTCC
CAAGATTCTGCTACTGCTCCTATTTTTTGGAGTTGTCCTGGTCATCTACTTGGCCCCCCTATGCATCTCC
TCACCCTGCATCATGGAACCCAGAGACTTACCACCCAAGCCTGGGCTGGTGGGACACCGAGGGGCCCCCA
TGCTGGCTCCCGAGAACACCCTGATGTCCTTGCGGAAGACAGCTGAATGCGGAGCTACTGTGTTTGAGAC
TGATGTGATGGTCAGCTCCGATGGGGTCCCCTTCCTCATGCATGATGAGCACCTCAGCAGGACCACGAAT
GTAGCCTCTGTATTCCCAACCCGAATCACAGCCCACAGCAGTGACTTCTCCTGGACTGAACTGAAGAGAC
TCAATGCTGGATCCTGGTTCCTAGAGAGGCGACCCTTCTGGGGGGCCAAACCGCTGGCAGGCCCTGATCA
GAAAGAGGCTGAGAGTCAGACGGTACCAGCATTAGAAGAGCTATTGGAGGAAGCTGCAGCCCTCAACCTT
TCCATCATGTTCGACTTGCGCCGACCCCCACAGAACCACACATACTATGACACTTTTGTGATCCAGACAT
TGGAGACTGTGCTGAATGCAAGGGTGCCCCAAGCCATGGTCTTTTGGCTACCAGATGAAGATCGGGCTAA
TGTCCAACGACGGGCACCTGGAATGCGCCAGATATATGGACGTCAGGGAGGCAACAGAACGGAGAGGCCC
CAGTTTCTTAACCTCCCCTATCAAGATCTGCCACTATTGGATATCAAGGCATTGCATAAGGATAATGTCT
CGGTGAACCTATTTGTAGTGAACAAGCCCTGGCTCTTCTCTCTGCTTTGGTGTGCAGGGGTGGATTCGGT
CACCACCAACGACTGCCAGCTGCTGCAGCAGATGCGTTACCCTATCTGGCTTATTACCCCTCAAACCTAC
CTAATCATATGGGTCATTACCAATTGTGTTTCCACCATGCTGCTTTTGTGGACCTTCCTCCTCCAAAGGA
GATTTGTTAAGAAGAGAGGGAAAACTGGCTTAGAAACAGCAGTGCTGCTGACAAGGATCAACAATTTCAT
GATGGAG


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC204415 protein sequence
Red=Cloning site Green=Tags(s)

MAESPGCCSVWARCLHCLYSCHWRKCPRERMQTSKCDCIWFGLLFLTFLLSLSWLYIGLVLLNDLHNFNE
FLFRRWGHWMDWSLAFLLVISLLVTYASLLLVLALLLRLCRQPLHLHSLHKVLLLLIMLLVAAGLVGLDI
QWQQEWHSLRVSLQATAPFLHIGAAAGIALLAWPVADTFYRIHRRGPKILLLLLFFGVVLVIYLAPLCIS
SPCIMEPRDLPPKPGLVGHRGAPMLAPENTLMSLRKTAECGATVFETDVMVSSDGVPFLMHDEHLSRTTN
VASVFPTRITAHSSDFSWTELKRLNAGSWFLERRPFWGAKPLAGPDQKEAESQTVPALEELLEEAAALNL
SIMFDLRRPPQNHTYYDTFVIQTLETVLNARVPQAMVFWLPDEDRANVQRRAPGMRQIYGRQGGNRTERP
QFLNLPYQDLPLLDIKALHKDNVSVNLFVVNKPWLFSLLWCAGVDSVTTNDCQLLQQMRYPIWLITPQTY
LIIWVITNCVSTMLLLWTFLLQRRFVKKRGKTGLETAVLLTRINNFMME

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_017711
ORF Size 1617 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_017711.2, NM_017711.3, NP_060181.2
RefSeq Size 2290
RefSeq ORF 1620
Locus ID 54857
Cytogenetics Xq13.1
Protein Families Transmembrane
MW 61.7 kDa
Gene Summary This gene encodes a member of the glycerophosphodiester phosphodiesterase enzyme family. The encoded protein hydrolyzes glycerophosphoinositol to produce inositol 1-phosphate and glycerol. This protein may have a role in osteoblast differentiation and growth. Alternate splicing results in multiple transcript variants. [provided by RefSeq, Jan 2010]

Other Versions

Other products for "GDPD2"
Frequently bought together (2)
Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 100 ul

USD 299.00


pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 550.00

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
BOGO Free lysates
68 Mouse Clones