RAB30 (NM_014488) Human Tagged ORF Clone

SKU
RC204318
RAB30 (Myc-DDK-tagged)-Human RAB30, member RAS oncogene family (RAB30)
  • TrueORF Gold

    Protein expression verified by Western blot, fully sequenced and in stock

    Click here to learn more.

$300.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol RAB30
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC204318 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGAGTATGGAAGATTATGATTTCCTGTTCAAAATTGTTTTAATTGGCAACGCTGGTGTGGGGAAGACGT
GCCTCGTCCGAAGATTCACTCAGGGTCTTTTCCCCCCAGGTCAAGGAGCCACAATTGGAGTTGATTTTAT
GATTAAGACAGTGGAGATTAATGGTGAAAAAGTAAAGCTACAGATCTGGGACACAGCAGGTCAAGAGAGA
TTTCGGTCCATTACCCAGAGTTACTACCGAAGCGCCAATGCCTTGATCCTCACCTATGACATTACCTGTG
AGGAATCCTTCCGTTGCCTTCCTGAGTGGCTGCGGGAGATAGAACAATATGCCAGCAACAAGGTCATCAC
TGTGTTAGTGGGCAACAAGATTGACCTGGCTGAAAGGAGAGAGGTTTCCCAGCAGCGAGCTGAAGAATTC
TCAGAAGCTCAGGACATGTATTATCTGGAGACCTCAGCCAAGGAATCTGATAATGTGGAGAAACTCTTCC
TTGACTTAGCATGCCGACTCATCAGTGAAGCCAGACAGAACACACTTGTGAACAATGTATCCTCACCCTT
ACCTGGAGAAGGGAAAAGCATCAGCTATTTGACTTGTTGTAATTTCAAC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC204318 protein sequence
Red=Cloning site Green=Tags(s)

MSMEDYDFLFKIVLIGNAGVGKTCLVRRFTQGLFPPGQGATIGVDFMIKTVEINGEKVKLQIWDTAGQER
FRSITQSYYRSANALILTYDITCEESFRCLPEWLREIEQYASNKVITVLVGNKIDLAERREVSQQRAEEF
SEAQDMYYLETSAKESDNVEKLFLDLACRLISEARQNTLVNNVSSPLPGEGKSISYLTCCNFN

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_014488
ORF Size 609 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_014488.5
RefSeq Size 9986 bp
RefSeq ORF 612 bp
Locus ID 27314
UniProt ID Q15771
Cytogenetics 11q14.1
Domains RAB, RAN, ras, RAS, RHO
Protein Families Druggable Genome
MW 23.1 kDa
Summary The small GTPases Rab are key regulators of intracellular membrane trafficking, from the formation of transport vesicles to their fusion with membranes. Rabs cycle between an inactive GDP-bound form and an active GTP-bound form that is able to recruit to membranes different set of downstream effectors directly responsible for vesicle formation, movement, tethering and fusion (By similarity). Required for maintaining the structural integrity of the Golgi apparatus, possibly by mediating interactions with cytoplasmic scaffolding proteins.[UniProtKB/Swiss-Prot Function]
Write Your Own Review
You're reviewing:RAB30 (NM_014488) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC204318L3 Lenti ORF clone of Human RAB30, member RAS oncogene family (RAB30), Myc-DDK-tagged 10 ug
$600.00
RC204318L4 Lenti ORF clone of Human RAB30, member RAS oncogene family (RAB30), mGFP tagged 10 ug
$600.00
RG204318 RAB30 (tGFP-tagged) - Human RAB30, member RAS oncogene family (RAB30) 10 ug
$489.00 MSRP $500.00 MSRP $500.00
SC114984 RAB30 (untagged)-Human RAB30, member RAS oncogene family (RAB30) 10 ug
$300.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.