G protein alpha Inhibitor 2 (GNAI2) (NM_002070) Human Tagged ORF Clone

SKU
RC204215
GNAI2 (Myc-DDK-tagged)-Human guanine nucleotide binding protein (G protein), alpha inhibiting activity polypeptide 2 (GNAI2), transcript variant 1
  • TrueORF Gold

    Protein expression verified by Western blot, fully sequenced and in stock

    Click here to learn more.

$457.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol G protein alpha Inhibitor 2
Synonyms GIP; GNAI2B; H_LUCA15.1; H_LUCA16.1
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC204215 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGGCTGCACCGTGAGCGCCGAGGACAAGGCGGCGGCCGAGCGCTCTAAGATGATCGACAAGAACCTGC
GGGAGGACGGAGAGAAGGCGGCGCGGGAGGTGAAGTTGCTGCTGTTGGGTGCTGGGGAGTCAGGGAAGAG
CACCATCGTCAAGCAGATGAAGATCATCCACGAGGATGGCTACTCCGAGGAGGAATGCCGGCAGTACCGG
GCGGTTGTCTACAGCAACACCATCCAGTCCATCATGGCCATTGTCAAAGCCATGGGCAACCTGCAGATCG
ACTTTGCCGACCCCTCCAGAGCGGACGACGCCAGGCAGCTATTTGCACTGTCCTGCACCGCCGAGGAGCA
AGGCGTGCTCCCTGATGACCTGTCCGGCGTCATCCGGAGGCTCTGGGCTGACCATGGTGTGCAGGCCTGC
TTTGGCCGCTCAAGGGAATACCAGCTCAACGACTCAGCTGCCTACTACCTGAACGACCTGGAGCGTATTG
CACAGAGTGACTACATCCCCACACAGCAAGATGTGCTACGGACCCGCGTAAAGACCACGGGGATCGTGGA
GACACACTTCACCTTCAAGGACCTACACTTCAAGATGTTTGATGTGGGTGGTCAGCGGTCTGAGCGGAAG
AAGTGGATCCACTGCTTTGAGGGCGTCACAGCCATCATCTTCTGCGTAGCCTTGAGCGCCTATGACTTGG
TGCTAGCTGAGGACGAGGAGATGAACCGCATGCATGAGAGCATGAAGCTATTCGATAGCATCTGCAACAA
CAAGTGGTTCACAGACACGTCCATCATCCTCTTCCTCAACAAGAAGGACCTGTTTGAGGAGAAGATCACA
CACAGTCCCCTGACCATCTGCTTCCCTGAGTACACAGGGGCCAACAAATATGATGAGGCAGCCAGCTACA
TCCAGAGTAAGTTTGAGGACCTGAATAAGCGCAAAGACACCAAGGAGATCTACACGCACTTCACGTGCGC
CACCGACACCAAGAACGTGCAGTTCGTGTTTGACGCCGTCACCGATGTCATCATCAAGAACAACCTGAAG
GACTGCGGCCTCTTC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC204215 protein sequence
Red=Cloning site Green=Tags(s)

MGCTVSAEDKAAAERSKMIDKNLREDGEKAAREVKLLLLGAGESGKSTIVKQMKIIHEDGYSEEECRQYR
AVVYSNTIQSIMAIVKAMGNLQIDFADPSRADDARQLFALSCTAEEQGVLPDDLSGVIRRLWADHGVQAC
FGRSREYQLNDSAAYYLNDLERIAQSDYIPTQQDVLRTRVKTTGIVETHFTFKDLHFKMFDVGGQRSERK
KWIHCFEGVTAIIFCVALSAYDLVLAEDEEMNRMHESMKLFDSICNNKWFTDTSIILFLNKKDLFEEKIT
HSPLTICFPEYTGANKYDEAASYIQSKFEDLNKRKDTKEIYTHFTCATDTKNVQFVFDAVTDVIIKNNLK
DCGLF

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_002070
ORF Size 1065 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_002070.4
RefSeq Size 2258 bp
RefSeq ORF 1068 bp
Locus ID 2771
UniProt ID P04899
Cytogenetics 3p21.31
Domains G-alpha
Protein Families Druggable Genome
Protein Pathways Axon guidance, Chemokine signaling pathway, Gap junction, Leukocyte transendothelial migration, Long-term depression, Melanogenesis, Progesterone-mediated oocyte maturation, Tight junction
MW 40.5 kDa
Summary The protein encoded by this gene is an alpha subunit of guanine nucleotide binding proteins (G proteins). The encoded protein contains the guanine nucleotide binding site and is involved in the hormonal regulation of adenylate cyclase. Several transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Sep 2013]
Write Your Own Review
You're reviewing:G protein alpha Inhibitor 2 (GNAI2) (NM_002070) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC204215L1 Lenti ORF clone of Human guanine nucleotide binding protein (G protein), alpha inhibiting activity polypeptide 2 (GNAI2), transcript variant 1, Myc-DDK-tagged 10 ug
$757.00
RC204215L2 Lenti ORF clone of Human guanine nucleotide binding protein (G protein), alpha inhibiting activity polypeptide 2 (GNAI2), transcript variant 1, mGFP tagged 10 ug
$757.00
RC204215L3 Lenti ORF clone of Human guanine nucleotide binding protein (G protein), alpha inhibiting activity polypeptide 2 (GNAI2), transcript variant 1, Myc-DDK-tagged 10 ug
$757.00
RC204215L4 Lenti ORF clone of Human guanine nucleotide binding protein (G protein), alpha inhibiting activity polypeptide 2 (GNAI2), transcript variant 1, mGFP tagged 10 ug
$757.00
RG204215 GNAI2 (tGFP-tagged) - Human guanine nucleotide binding protein (G protein), alpha inhibiting activity polypeptide 2 (GNAI2), transcript variant 1 10 ug
$489.00 MSRP $657.00 MSRP $657.00
SC118850 GNAI2 (untagged)-Human guanine nucleotide binding protein (G protein), alpha inhibiting activity polypeptide 2 (GNAI2), transcript variant 1 10 ug
$457.00
SC320935 GNAI2 (untagged)-Human guanine nucleotide binding protein (G protein), alpha inhibiting activity polypeptide 2 (GNAI2), transcript variant 1 10 ug
$457.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.