DPH3 (NM_206831) Human Tagged ORF Clone

SKU
RC204203
DPH3 (Myc-DDK-tagged)-Human DPH3, KTI11 homolog (S. cerevisiae) (DPH3), transcript variant 1
  • TrueORF Gold

    Protein expression verified by Western blot, fully sequenced and in stock

    Click here to learn more.

$150.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol DPH3
Synonyms DELGIP; DELGIP1; DESR1; DPH3A; KTI11; ZCSL2
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC204203 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCAGTGTTTCATGACGAGGTGGAAATCGAGGACTTCCAATATGACGAGGACTCGGAGACGTATTTCT
ATCCCTGCCCATGTGGAGATAACTTCTCCATCACCAAGGAAGATTTGGAGAATGGGGAAGACGTGGCAAC
GTGTCCTAGCTGCTCTCTCATTATAAAAGTGATTTATGACAAAGATCAGTTTGTGTGTGGAGAAACAGTC
CCAGCCCCTTCAGCCAACAAAGAATTAGTTAAATGC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC204203 protein sequence
Red=Cloning site Green=Tags(s)

MAVFHDEVEIEDFQYDEDSETYFYPCPCGDNFSITKEDLENGEDVATCPSCSLIIKVIYDKDQFVCGETV
PAPSANKELVKC

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_206831
ORF Size 246 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_206831.3
RefSeq Size 4065 bp
RefSeq ORF 249 bp
Locus ID 285381
UniProt ID Q96FX2
Cytogenetics 3p25.1
MW 9.2 kDa
Summary This gene encodes a CSL zinc finger-containing protein that is required for dipthamide biosynthesis. The encoded protein is necessary for the initial step in the modification of a histidine residue in elongation factor-2 to diphthamide. This modified residue is a target for ADP ribosylation by the bacterial toxins diphtheria toxin and Pseudomonas exotoxin A. Alternative splicing results in multiple transcript variants that encode the same isoform. [provided by RefSeq, Feb 2009]
Write Your Own Review
You're reviewing:DPH3 (NM_206831) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC204203L3 Lenti ORF clone of Human DPH3, KTI11 homolog (S. cerevisiae) (DPH3), transcript variant 1, Myc-DDK-tagged 10 ug
$450.00
RC204203L4 Lenti ORF clone of Human DPH3, KTI11 homolog (S. cerevisiae) (DPH3), transcript variant 1, mGFP tagged 10 ug
$450.00
RG204203 DPH3 (tGFP-tagged) - Human DPH3, KTI11 homolog (S. cerevisiae) (DPH3), transcript variant 1 10 ug
$489.00
SC321622 DPH3 (untagged)-Human DPH3, KTI11 homolog (S. cerevisiae) (DPH3), transcript variant 1 10 ug
$150.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.