HDGF (NM_004494) Human Tagged ORF Clone

SKU
RC204148
HDGF (Myc-DDK-tagged)-Human hepatoma-derived growth factor (HDGF), transcript variant 1
  • TrueORF Gold

    Protein expression verified by Western blot, fully sequenced and in stock

    Click here to learn more.

$300.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol HDGF
Synonyms HMG1L2
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC204148 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGTCGCGATCCAACCGGCAGAAGGAGTACAAATGCGGGGACCTGGTGTTCGCCAAGATGAAGGGCTACC
CACACTGGCCGGCCCGGATTGACGAGATGCCTGAGGCTGCCGTGAAATCAACAGCCAACAAATACCAAGT
CTTTTTTTTCGGGACCCACGAGACGGCATTCCTGGGCCCCAAAGACCTCTTCCCTTACGAGGAATCCAAG
GAGAAGTTTGGCAAGCCCAACAAGAGGAAAGGGTTCAGCGAGGGGCTGTGGGAGATCGAAAACAACCCTA
CTGTCAAGGCTTCCGGCTATCAGTCCTCCCAGAAAAAGAGCTGTGTGGAAGAGCCTGAACCAGAGCCCGA
AGCTGCAGAGGGTGACGGTGATAAGAAGGGGAATGCAGAGGGCAGCAGCGACGAGGAAGGGAAGCTGGTC
ATTGATGAGCCAGCCAAGGAGAAGAACGAGAAAGGAGCGTTGAAGAGGAGAGCAGGGGACTTGCTGGAGG
ACTCTCCTAAACGTCCCAAGGAGGCAGAAAACCCTGAAGGAGAGGAGAAGGAGGCAGCCACCTTGGAGGT
TGAGAGGCCCCTTCCTATGGAGGTGGAAAAGAATAGCACCCCCTCTGAGCCCGGCTCTGGCCGGGGGCCT
CCCCAAGAGGAAGAAGAAGAGGAGGATGAAGAGGAAGAGGCTACCAAGGAAGATGCTGAGGCCCCAGGCA
TCAGAGATCATGAGAGCCTG


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC204148 protein sequence
Red=Cloning site Green=Tags(s)

MSRSNRQKEYKCGDLVFAKMKGYPHWPARIDEMPEAAVKSTANKYQVFFFGTHETAFLGPKDLFPYEESK
EKFGKPNKRKGFSEGLWEIENNPTVKASGYQSSQKKSCVEEPEPEPEAAEGDGDKKGNAEGSSDEEGKLV
IDEPAKEKNEKGALKRRAGDLLEDSPKRPKEAENPEGEEKEAATLEVERPLPMEVEKNSTPSEPGSGRGP
PQEEEEEEDEEEEATKEDAEAPGIRDHESL

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_004494
ORF Size 720 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_004494.3
RefSeq Size 2397 bp
RefSeq ORF 723 bp
Locus ID 3068
UniProt ID P51858
Cytogenetics 1q23.1
Domains PWWP
MW 26.8 kDa
Summary This gene encodes a member of the hepatoma-derived growth factor family. The encoded protein has mitogenic and DNA-binding activity and may play a role in cellular proliferation and differentiation. High levels of expression of this gene enhance the growth of many tumors. This gene was thought initially to be located on chromosome X; however, that location has been determined to correspond to a related pseudogene. Alternatively spliced transcript variants encoding distinct isoforms have been described. [provided by RefSeq, Jan 2016]
Write Your Own Review
You're reviewing:HDGF (NM_004494) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC204148L1 Lenti ORF clone of Human hepatoma-derived growth factor (HDGF), transcript variant 1, Myc-DDK-tagged 10 ug
$600.00
RC204148L2 Lenti ORF clone of Human hepatoma-derived growth factor (HDGF), transcript variant 1, mGFP tagged 10 ug
$600.00
RC204148L3 Lenti ORF clone of Human hepatoma-derived growth factor (HDGF), transcript variant 1, Myc-DDK-tagged 10 ug
$600.00
RC204148L4 Lenti ORF clone of Human hepatoma-derived growth factor (HDGF), transcript variant 1, mGFP tagged 10 ug
$600.00
RG204148 HDGF (tGFP-tagged) - Human hepatoma-derived growth factor (HDGF), transcript variant 1 10 ug
$489.00 MSRP $500.00 MSRP $500.00
SC117340 HDGF (untagged)-Human hepatoma-derived growth factor (HDGF), transcript variant 1 10 ug
$300.00
SC320791 HDGF (untagged)-Human hepatoma-derived growth factor (HDGF), transcript variant 1 10 ug
$300.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.