Synaptogyrin 3 (SYNGR3) (NM_004209) Human Tagged ORF Clone

SKU
RC204126
SYNGR3 (Myc-DDK-tagged)-Human synaptogyrin 3 (SYNGR3)
  • TrueORF Gold

    Protein expression verified by Western blot, fully sequenced and in stock

    Click here to learn more.

$300.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol Synaptogyrin 3
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC204126 representing NM_004209.
Blue=ORF Red=Cloning site Green=Tag(s)

GCTCGTTTAGTGAACCGTCAGAATTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTG
GATCCAGTACCGAGGAGATCTGCCGCCGCGATCGCC
ATGGAGGGCGCCTCCTTCGGCGCGGGCCGCGCAGGGGCCGCCCTGGACCCCGTGAGCTTTGCGCGGCGG
CCCCAGACCCTGCTCCGGGTCGCGTCCTGGGTGTTCTCCATCGCCGTCTTCGGGCCCATCGTCAACGAG
GGCTACGTGAACACCGACAGCGGCCCCGAGCTGCGCTGCGTGTTCAACGGGAACGCGGGCGCCTGCCGC
TTCGGCGTCGCGCTGGGCCTCGGAGCCTTCCTCGCCTGCGCCGCCTTCCTGCTGCTCGATGTGCGCTTC
CAGCAAATCAGCAGCGTCCGCGACCGCCGGCGCGCGGTGTTGCTGGACCTGGGCTTCTCAGGACTCTGG
TCCTTCCTGTGGTTCGTGGGCTTCTGCTTCCTCACCAATCAGTGGCAGCGCACGGCGCCAGGGCCGGCC
ACGACGCAGGCGGGGGACGCGGCGCGGGCCGCCATCGCCTTCAGCTTCTTCTCCATCCTCAGCTGGGTG
GCGCTCACCGTGAAGGCCCTGCAGCGGTTCCGCCTGGGCACCGACATGTCACTCTTCGCCACCGAACAG
CTGAGCACCGGGGCGAGCCAGGCCTACCCCGGCTATCCGGTGGGCAGCGGCGTGGAGGGCACCGAGACC
TACCAGAGCCCGCCCTTCACCGAGACCCTGGACACCAGCCCCAAAGGGTACCAGGTGCCCGCCTAC

ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGAT
TACAAGGATGACGACGATAAG
GTTTAAACGGCCGGC
Protein Sequence
>Peptide sequence encoded by RC204126
Blue=ORF Red=Cloning site Green=Tag(s)

MEGASFGAGRAGAALDPVSFARRPQTLLRVASWVFSIAVFGPIVNEGYVNTDSGPELRCVFNGNAGACR
FGVALGLGAFLACAAFLLLDVRFQQISSVRDRRRAVLLDLGFSGLWSFLWFVGFCFLTNQWQRTAPGPA
TTQAGDAARAAIAFSFFSILSWVALTVKALQRFRLGTDMSLFATEQLSTGASQAYPGYPVGSGVEGTET
YQSPPFTETLDTSPKGYQVPAY

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_004209
ORF Size 687 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_004209.6
RefSeq Size 2076 bp
RefSeq ORF 690 bp
Locus ID 9143
UniProt ID O43761
Cytogenetics 16p13.3
Domains Synaptogyrin
Protein Families Transmembrane
MW 24.6 kDa
Summary This gene encodes an integral membrane protein. The exact function of this protein is unclear, but studies of a similar murine protein suggest that it is a synaptic vesicle protein that also interacts with the dopamine transporter. The gene product belongs to the synaptogyrin gene family. [provided by RefSeq, Dec 2010]
Write Your Own Review
You're reviewing:Synaptogyrin 3 (SYNGR3) (NM_004209) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC204126L1 Lenti ORF clone of Human synaptogyrin 3 (SYNGR3), Myc-DDK-tagged 10 ug
$600.00
RC204126L2 Lenti ORF clone of Human synaptogyrin 3 (SYNGR3), mGFP tagged 10 ug
$600.00
RC204126L3 Lenti ORF clone of Human synaptogyrin 3 (SYNGR3), Myc-DDK-tagged 10 ug
$600.00
RC204126L4 Lenti ORF clone of Human synaptogyrin 3 (SYNGR3), mGFP tagged 10 ug
$600.00
RG204126 SYNGR3 (tGFP-tagged) - Human synaptogyrin 3 (SYNGR3) 10 ug
$489.00 MSRP $500.00 MSRP $500.00
SC319923 SYNGR3 (untagged)-Human synaptogyrin 3 (SYNGR3) 10 ug
$300.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.