NUDT4 (NM_019094) Human Tagged ORF Clone

SKU
RC204100
NUDT4 (Myc-DDK-tagged)-Human nudix (nucleoside diphosphate linked moiety X)-type motif 4 (NUDT4), transcript variant 1
  • TrueORF Gold

    Protein expression verified by Western blot, fully sequenced and in stock

    Click here to learn more.

$300.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol NUDT4
Synonyms DIPP-2B; DIPP2; DIPP2alpha; DIPP2beta; HDCMB47P; NUDT4B
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC204100 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGATGAAGTTCAAGCCCAACCAGACGCGGACCTACGACCGCGAGGGCTTCAAGAAGCGGGCGGCGTGCC
TGTGCTTCCGGAGCGAGCAGGAGGACGAGGTGCTGCTGGTGAGTAGCAGCCGGTACCCAGACCAGTGGAT
TGTCCCAGGAGGAGGAATGGAACCCGAGGAGGAACCTGGCGGTGCTGCCGTGAGGGAAGTTTATGAGGAG
GCTGGAGTCAAAGGAAAACTAGGCAGACTTCTGGGCATATTTGAGCAGAACCAAGACCGAAAGCACAGAA
CATATGTTTATGTTCTAACAGTCACTGAAATATTAGAAGATTGGGAAGATTCTGTTAATATTGGAAGGAA
GAGAGAGTGGTTCAAAGTAGAAGATGCTATCAAAGTTCTCCAGTGTCATAAACCTGTACATGCAGAGTAT
CTGGAAAAGCTAAAGCTGGGTTGTTCCCCAGCCAATGGAAATTCTACAGTCCCTTCCCTTCCGGATAATA
ATGCCTTGTTTGTAACCGCTGCACAGACCTCTGGGTTGCCATCTAGTGTAAGA


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC204100 protein sequence
Red=Cloning site Green=Tags(s)

MMKFKPNQTRTYDREGFKKRAACLCFRSEQEDEVLLVSSSRYPDQWIVPGGGMEPEEEPGGAAVREVYEE
AGVKGKLGRLLGIFEQNQDRKHRTYVYVLTVTEILEDWEDSVNIGRKREWFKVEDAIKVLQCHKPVHAEY
LEKLKLGCSPANGNSTVPSLPDNNALFVTAAQTSGLPSSVR

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_019094
ORF Size 543 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_019094.2
RefSeq Size 4812 bp
RefSeq ORF 543 bp
Locus ID 11163
UniProt ID Q9NZJ9
Cytogenetics 12q22
Domains NUDIX
Protein Families Druggable Genome
MW 20.4 kDa
Summary The protein encoded by this gene regulates the turnover of diphosphoinositol polyphosphates. The turnover of these high-energy diphosphoinositol polyphosphates represents a molecular switching activity with important regulatory consequences. Molecular switching by diphosphoinositol polyphosphates may contribute to regulating intracellular trafficking. Several alternatively spliced transcript variants have been described, but the full-length nature of some variants has not been determined. Isoforms DIPP2alpha and DIPP2beta are distinguishable from each other solely by DIPP2beta possessing one additional amino acid due to intron boundary skidding in alternate splicing. [provided by RefSeq, Jul 2008]
Write Your Own Review
You're reviewing:NUDT4 (NM_019094) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC204100L3 Lenti ORF clone of Human nudix (nucleoside diphosphate linked moiety X)-type motif 4 (NUDT4), transcript variant 1, Myc-DDK-tagged 10 ug
$600.00
RC204100L4 Lenti ORF clone of Human nudix (nucleoside diphosphate linked moiety X)-type motif 4 (NUDT4), transcript variant 1, mGFP tagged 10 ug
$600.00
RG204100 NUDT4 (tGFP-tagged) - Human nudix (nucleoside diphosphate linked moiety X)-type motif 4 (NUDT4), transcript variant 1 10 ug
$489.00 MSRP $500.00 MSRP $500.00
SC111763 NUDT4 (untagged)-Human nudix (nucleoside diphosphate linked moiety X)-type motif 4 (NUDT4), transcript variant 1 10 ug
$1,372.00
SC320783 NUDT4 (untagged)-Human nudix (nucleoside diphosphate linked moiety X)-type motif 4 (NUDT4), transcript variant 1 10 ug
$300.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.