GNB1L (NM_053004) Human Tagged ORF Clone

SKU
RC204086
GNB1L (Myc-DDK-tagged)-Human guanine nucleotide binding protein (G protein), beta polypeptide 1-like (GNB1L)
  • TrueORF Gold

    Protein expression verified by Western blot, fully sequenced and in stock

    Click here to learn more.

$300.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol GNB1L
Synonyms DGCRK3; FKSG1; GY2; WDR14; WDVCF
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC204086 representing NM_053004
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGACGGCCCCCTGCCCGCCGCCACCTCCAGACCCCCAGTTTGTCCTCCGAGGCACCCAGTCACCGGTGC
ATGCGCTGCACTTCTGCGAAGGAGCCCAGGCTCAGGGGCGCCCGCTCCTCTTCTCAGGGTCTCAGAGTGG
CCTGGTACACATCTGGAGCCTGCAGACGCGGAGAGCGGTTACCACCCTGGATGGCCACGGCGGCCAGTGT
GTGACCTGGCTGCAGACGCTGCCCCAGGGGCGCCAGCTCCTCAGTCAGGGCCGGGACCTGAAGCTGTGCC
TGTGGGACCTCGCGGAGGGCAGGAGCGCTGTCGTGGACTCCGTGTGCTTGGAGAGTGTGGGCTTCTGCCG
GAGCAGCATCCTGGCCGGGGGCCAGCCACGCTGGACGCTTGCCGTGCCAGGGAGGGGCAGCGACGAGGTT
CAGATTCTGGAGATGCCCTCCAAGACGTCAGTGTGCGCCCTGAAGCCGAAGGCAGATGCCAAGCTGGGCA
TGCCCATGTGCCTGCGGCTGTGGCAGGCCGACTGCAGCTCCCGCCCACTCCTTCTGGCCGGCTATGAGGA
TGGATCGGTGGTCCTGTGGGACGTCTCTGAGCAGAAGGTGTGCAGCCGCATCGCCTGCCATGAGGAGCCC
GTCATGGACCTTGACTTTGACTCCCAGAAGGCCAGGGGCATCTCAGGCTCCGCGGGGAAGGCGCTGGCTG
TCTGGAGCCTGGACTGGCAGCAGGCCCTGCAGGTGCGTGGGACTCATGAACTCACCAATCCCGGGATCGC
CGAGGTCACGATCCGGCCAGATCGCAAGATCCTGGCCACCGCAGGCTGGGACCACCGCATCCGCGTGTTC
CACTGGCGGACGATGCAGCCACTGGCCGTGCTGGCCTTCCACAGCGCCGCTGTCCAGTGCGTGGCCTTCA
CCGCCGATGGCTTGCTGGCCGCGGGCTCCAAGGATCAGCGGATCAGCCTCTGGTCACTCTACCCACGCGC
A


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC204086 representing NM_053004
Red=Cloning site Green=Tags(s)

MTAPCPPPPPDPQFVLRGTQSPVHALHFCEGAQAQGRPLLFSGSQSGLVHIWSLQTRRAVTTLDGHGGQC
VTWLQTLPQGRQLLSQGRDLKLCLWDLAEGRSAVVDSVCLESVGFCRSSILAGGQPRWTLAVPGRGSDEV
QILEMPSKTSVCALKPKADAKLGMPMCLRLWQADCSSRPLLLAGYEDGSVVLWDVSEQKVCSRIACHEEP
VMDLDFDSQKARGISGSAGKALAVWSLDWQQALQVRGTHELTNPGIAEVTIRPDRKILATAGWDHRIRVF
HWRTMQPLAVLAFHSAAVQCVAFTADGLLAAGSKDQRISLWSLYPRA

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_053004
ORF Size 981 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_053004.3
RefSeq Size 1537 bp
RefSeq ORF 984 bp
Locus ID 54584
UniProt ID Q9BYB4
Cytogenetics 22q11.21
Domains WD40
Protein Families Druggable Genome
MW 35.4 kDa
Summary This gene encodes a G-protein beta-subunit-like polypeptide which is a member of the WD repeat protein family. WD repeats are minimally conserved regions of approximately 40 amino acids typically bracketed by gly-his and trp-asp (GH-WD), which may facilitate formation of heterotrimeric or multiprotein complexes. Members of this family are involved in a variety of cellular processes, including cell cycle progression, signal transduction, apoptosis, and gene regulation. This protein contains 6 WD repeats and is highly expressed in the heart. The gene maps to the region on chromosome 22q11, which is deleted in DiGeorge syndrome, trisomic in derivative 22 syndrome and tetrasomic in cat-eye syndrome. Therefore, this gene may contribute to the etiology of those disorders. Transcripts from this gene share exons with some transcripts from the C22orf29 gene. [provided by RefSeq, Jul 2008]
Write Your Own Review
You're reviewing:GNB1L (NM_053004) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC204086L1 Lenti ORF clone of Human guanine nucleotide binding protein (G protein), beta polypeptide 1-like (GNB1L), Myc-DDK-tagged 10 ug
$600.00
RC204086L2 Lenti ORF clone of Human guanine nucleotide binding protein (G protein), beta polypeptide 1-like (GNB1L), mGFP tagged 10 ug
$600.00
RC204086L3 Lenti ORF clone of Human guanine nucleotide binding protein (G protein), beta polypeptide 1-like (GNB1L), Myc-DDK-tagged 10 ug
$600.00
RC204086L4 Lenti ORF clone of Human guanine nucleotide binding protein (G protein), beta polypeptide 1-like (GNB1L), mGFP tagged 10 ug
$600.00
RG204086 GNB1L (tGFP-tagged) - Human guanine nucleotide binding protein (G protein), beta polypeptide 1-like (GNB1L) 10 ug
$500.00
SC120188 GNB1L (untagged)-Human guanine nucleotide binding protein (G protein), beta polypeptide 1-like (GNB1L) 10 ug
$300.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.