OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

FHL3 (NM_004468) Human Tagged ORF Clone

  • Product Brand Image
Be the first to review this product
SKU
RC203991
FHL3 (Myc-DDK-tagged)-Human four and a half LIM domains 3 (FHL3)
ORF Plasmid:
DDK tGFP
Lentiviral Particles:
DDK w/ Puro mGFP w/ Puro
AAV Particle:
DDK
  $300.00
In Stock*
Bulk Requests & Clone Modifications

Frequently Bought Together (6)

TA349986 Rabbit Polyclonal Anti-FHL3 Antibody
100 ul
$205.00
TA592569S DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
30 ul
$200.00
CC100003 DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
5 x 200 ul
$170.00
PRIMER Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
100 pmol
$59.00
PS100001 pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
10 ug
$670.00
AR100028M DDKTrap Anti-DDK 8G6 affinity resin used for the purification of DDK, DYKDDDDK, or FLAG® tagged proteins , 5 mL
5 ml
$750.00

Other products for "FHL3 or NM_004468"

Specifications
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol FHL3
Synonyms SLIM2
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC203991 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGAGCGAGTCATTTGACTGTGCAAAATGCAACGAGTCCCTGTATGGACGCAAGTACATCCAGACAGACA
GCGGCCCCTACTGTGTGCCCTGCTATGACAATACCTTTGCCAACACCTGTGCTGAGTGCCAGCAGCTTAT
CGGGCATGACTCGAGGGAGCTGTTCTATGAAGACCGCCATTTCCACGAGGGCTGCTTCCGCTGCTGCCGC
TGCCAGCGCTCACTAGCCGATGAACCCTTCACCTGCCAGGACAGTGAGCTGCTCTGCAATGACTGCTACT
GCAGTGCGTTTTCCTCGCAGTGCTCCGCTTGTGGGGAGACTGTCATGCCTGGGTCCCGGAAGCTGGAATA
TGGAGGCCAGACATGGCATGAGCACTGCTTCCTGTGCAGTGGCTGTGAACAGCCACTGGGCTCCCGTTCT
TTTGTGCCCGACAAGGGTGCTCACTACTGCGTGCCCTGCTATGAGAACAAGTTTGCTCCTCGCTGCGCCC
GCTGCAGCAAGACGCTGACACAGGGTGGAGTGACATACCGTGATCAGCCGTGGCATCGAGAATGTCTGGT
CTGTACCGGATGCCAGACGCCCCTGGCAGGGCAGCAGTTCACCTCCCGGGATGAAGATCCCTACTGTGTG
GCCTGTTTTGGAGAACTCTTTGCACCTAAGTGCAGCAGCTGCAAGCGCCCCATCGTAGGACTCGGTGGAG
GCAAGTATGTGTCCTTTGAAGACCGACACTGGCACCACAACTGCTTCTCCTGCGCCCGCTGCTCTACCTC
CCTGGTGGGCCAGGGCTTCGTACCGGATGGAGACCAAGTGCTCTGCCAGGGCTGTAGCCAGGCAGGGCCC

ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAGGTTTAA
Protein Sequence
>RC203991 protein sequence
Red=Cloning site Green=Tags(s)

MSESFDCAKCNESLYGRKYIQTDSGPYCVPCYDNTFANTCAECQQLIGHDSRELFYEDRHFHEGCFRCCR
CQRSLADEPFTCQDSELLCNDCYCSAFSSQCSACGETVMPGSRKLEYGGQTWHEHCFLCSGCEQPLGSRS
FVPDKGAHYCVPCYENKFAPRCARCSKTLTQGGVTYRDQPWHRECLVCTGCQTPLAGQQFTSRDEDPYCV
ACFGELFAPKCSSCKRPIVGLGGGKYVSFEDRHWHHNCFSCARCSTSLVGQGFVPDGDQVLCQGCSQAGP

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene | Plasmid Map
ACCN NM_004468
ORF Size 840 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_004468.5
RefSeq Size 1662 bp
RefSeq ORF 843 bp
Locus ID 2275
UniProt ID Q13643
Cytogenetics 1p34.3
Domains LIM
MW 31.2 kDa
Summary The protein encoded by this gene is a member of a family of proteins containing a four-and-a-half LIM domain, which is a highly conserved double zinc finger motif. The encoded protein has been shown to interact with the cancer developmental regulators SMAD2, SMAD3, and SMAD4, the skeletal muscle myogenesis protein MyoD, and the high-affinity IgE beta chain regulator MZF-1. This protein may be involved in tumor suppression, repression of MyoD expression, and repression of IgE receptor expression. Two transcript variants encoding different isoforms have been found for this gene. provided by RefSeq, Aug 2011
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
"NM_004468" in other vectors (4)
SKU Description Size Price
RC203991L3 Lenti ORF clone of Human four and a half LIM domains 3 (FHL3), Myc-DDK-tagged 10 ug
$600.00
RC203991L4 Lenti ORF clone of Human four and a half LIM domains 3 (FHL3), mGFP tagged 10 ug
$600.00
RG203991 FHL3 (tGFP-tagged) - Human four and a half LIM domains 3 (FHL3) 10 ug
$489.00 $500.00
SC117379 FHL3 (untagged)-Human four and a half LIM domains 3 (FHL3) 10 ug
$300.00

Plasmid Map for RC203991

Download sequence for

file-download TXT (FASTA format)

file-download Genbank

Cloning scheme for RC203991
Circular map for RC203991

file-alt Citations

BMP signaling is enhanced intracellularly by FHL3 controlling WNT-dependent spatiotemporal emergence of the neural crest
Alkobtawi, Pla, Monsoro-Burq
Cell Rep (2021) 35 (12), 109289 DOI: 10.1016/j.celrep.2021.109289
Cited by 17
AI Summary: OriGene’s pCMV6-FHL3-FLAG cDNA (RC203991) was used in this study to investigate the role of FHL3 in modulating BMP signaling and WNT-dependent neural crest development.
Snippet: Homo sapiens cDNA caSmad1 (3SD), (Kumar et al., 2018), N/A. Xenopus laevis cDNA pCS107-Fhl3, This article, N/A. Homo Sapiens cDNA pCMV6-FHL3-FLAG, OriGene Technologies, RC203991. Homo Sapiens cDNA pOBT-FHL3, BC001351,, Dharmacon, Clone
Intracellular enhancement of BMP signaling by LIM-domain protein FHL3 controls spatiotemporal emergence of the neural crest driven by WNT signaling
Alkobtawi, Pla, Monsoro-Burq
bioRxiv (2019)
Snippet: Page 1. 1 Intracellular enhancement of BMP signaling by LIM-domain protein FHL3 controls spatiotemporal emergence of the neural crest driven by WNT signaling. Mansour Alkobtawi1,2, Patrick Pla1,2§ and Anne H. Monsoro-Burq1,2,3§*. 1, Univ View as HTML;Xenopus laevis cDNA pGEMT-Fhl3 This article N/A Xenopus laevis cDNA pCS107-Fhl3 This article N/A Homo Sapiens cDNA pCMV6-FHL3-FLAG OriGene Technologies RC203991 Homo Sapiens cDNA pOBT-FHL3 Dharmacon BC001351, Clone ID: 2964682 Homo Sapiens cDNA pCS2-FHL3 This article Xenopus laevis cDNA pCS2+-Foxd3 (Sasai et al., 2001) N/A
Showing 1-2 of 2 papers.
Powered by BizGenius
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products