APOBEC3C (NM_014508) Human Tagged ORF Clone

SKU
RC203971
APOBEC3C (Myc-DDK-tagged)-Human apolipoprotein B mRNA editing enzyme, catalytic polypeptide-like 3C (APOBEC3C)
  • TrueORF Gold

    Protein expression verified by Western blot, fully sequenced and in stock

    Click here to learn more.

$450.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol APOBEC3C
Synonyms A3C; APOBEC1L; ARDC2; ARDC4; ARP5; bK150C2.3; PBI
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC203971 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGAATCCACAGATCAGAAACCCGATGAAGGCAATGTATCCAGGCACATTCTACTTCCAATTTAAAAACC
TATGGGAAGCCAACGATCGGGACGAAACTTGGCTGTGCTTCACCGTGGAAGGTATAAAGCGCCGCTCAGT
TGTCTCCTGGAAGACGGGCGTCTTCCGAAACCAGGTGGATTCTGAGACCCATTGTCATGCAGAAAGGTGC
TTCCTCTCTTGGTTCTGCGACGACATACTGTCTCCTAACACAAAGTACCAGGTCACCTGGTACACATCTT
GGAGCCCTTGCCCAGACTGTGCAGGGGAGGTGGCCGAGTTCCTGGCCAGGCACAGCAACGTGAATCTCAC
CATCTTCACCGCCCGCCTCTACTACTTCCAGTATCCATGTTACCAGGAGGGGCTCCGCAGCCTGAGTCAG
GAAGGGGTCGCTGTGGAGATCATGGACTATGAAGATTTTAAATATTGTTGGGAAAACTTTGTGTACAATG
ATAATGAGCCATTCAAGCCTTGGAAGGGATTAAAAACCAACTTTCGACTTCTGAAAAGAAGGCTACGGGA
GAGTCTCCAG


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC203971 protein sequence
Red=Cloning site Green=Tags(s)

MNPQIRNPMKAMYPGTFYFQFKNLWEANDRDETWLCFTVEGIKRRSVVSWKTGVFRNQVDSETHCHAERC
FLSWFCDDILSPNTKYQVTWYTSWSPCPDCAGEVAEFLARHSNVNLTIFTARLYYFQYPCYQEGLRSLSQ
EGVAVEIMDYEDFKYCWENFVYNDNEPFKPWKGLKTNFRLLKRRLRESLQ

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_014508
ORF Size 570 bp
OTI Disclaimer Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery.

The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_014508.1
RefSeq Size 1127 bp
RefSeq ORF 573 bp
Locus ID 27350
UniProt ID Q9NRW3
Cytogenetics 22q13.1
MW 22.8 kDa
Summary This gene is a member of the cytidine deaminase gene family. It is one of seven related genes or pseudogenes found in a cluster thought to result from gene duplication, on chromosome 22. Members of the cluster encode proteins that are structurally and functionally related to the C to U RNA-editing cytidine deaminase APOBEC1. It is thought that the proteins may be RNA editing enzymes and have roles in growth or cell cycle control. [provided by RefSeq, Jul 2008]
Write Your Own Review
You're reviewing:APOBEC3C (NM_014508) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC203971L1 Lenti ORF clone of Human apolipoprotein B mRNA editing enzyme, catalytic polypeptide-like 3C (APOBEC3C), Myc-DDK-tagged 10 ug
$750.00
RC203971L2 Lenti ORF clone of Human apolipoprotein B mRNA editing enzyme, catalytic polypeptide-like 3C (APOBEC3C), mGFP tagged 10 ug
$750.00
RC203971L3 Lenti ORF clone of Human apolipoprotein B mRNA editing enzyme, catalytic polypeptide-like 3C (APOBEC3C), Myc-DDK-tagged 10 ug
$750.00
RC203971L4 Lenti ORF clone of Human apolipoprotein B mRNA editing enzyme, catalytic polypeptide-like 3C (APOBEC3C), mGFP tagged 10 ug
$750.00
RG203971 APOBEC3C (tGFP-tagged) - Human apolipoprotein B mRNA editing enzyme, catalytic polypeptide-like 3C (APOBEC3C) 10 ug
$650.00
SC309155 APOBEC3C (untagged)-Human apolipoprotein B mRNA editing enzyme, catalytic polypeptide-like 3C (APOBEC3C) 10 ug
$480.00
SC320908 APOBEC3C (untagged)-Human apolipoprotein B mRNA editing enzyme, catalytic polypeptide-like 3C (APOBEC3C) 10 ug
$450.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.