NHLH1 (NM_005598) Human Tagged ORF Clone

SKU
RC203893
NHLH1 (Myc-DDK-tagged)-Human nescient helix loop helix 1 (NHLH1)
  • TrueORF Gold

    Protein expression verified by Western blot, fully sequenced and in stock

    Click here to learn more.

$150.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol NHLH1
Synonyms bHLHa35; HEN1; NSCL; NSCL1
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC203893 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGATGCTCAACTCAGACACCATGGAGCTGGACCTGCCGCCCACCCACTCAGAGACTGAGTCGGGCTTCA
GTGACTGTGGGGGCGGGGCGGGCCCTGATGGTGCCGGGCCTGGGGGTCCGGGAGGGGGCCAGGCCCGAGG
CCCAGAGCCGGGAGAGCCTGGCCGGAAAGACCTGCAGCATCTGAGCCGCGAGGAGCGCCGGCGCCGGCGC
CGCGCCACAGCCAAGTACCGCACGGCCCACGCCACGCGAGAACGCATCCGCGTGGAAGCCTTCAACCTGG
CCTTCGCCGAGCTGCGCAAGCTGCTGCCTACGCTGCCCCCCGACAAGAAGCTCTCCAAGATTGAGATTCT
GCGCCTGGCCATCTGCTATATCTCCTACCTGAACCACGTGCTGGACGTC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC203893 protein sequence
Red=Cloning site Green=Tags(s)

MMLNSDTMELDLPPTHSETESGFSDCGGGAGPDGAGPGGPGGGQARGPEPGEPGRKDLQHLSREERRRRR
RATAKYRTAHATRERIRVEAFNLAFAELRKLLPTLPPDKKLSKIEILRLAICYISYLNHVLDV

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_005598
ORF Size 399 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_005598.4
RefSeq Size 2594 bp
RefSeq ORF 402 bp
Locus ID 4807
UniProt ID Q02575
Cytogenetics 1q23.2
Protein Families Transcription Factors
MW 14.6 kDa
Summary The helix-loop-helix (HLH) proteins are a family of putative transcription factors, some of which have been shown to play an important role in growth and development of a wide variety of tissues and species. Four members of this family have been clearly implicated in tumorigenesis via their involvement in chromosomal translocations in lymphoid tumors: MYC (MIM 190080), LYL1 (MIM 151440), E2A (MIM 147141), and SCL (MIM 187040).[supplied by OMIM, Nov 2002]
Write Your Own Review
You're reviewing:NHLH1 (NM_005598) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC203893L1 Lenti ORF clone of Human nescient helix loop helix 1 (NHLH1), Myc-DDK-tagged 10 ug
$450.00
RC203893L2 Lenti ORF clone of Human nescient helix loop helix 1 (NHLH1), mGFP tagged 10 ug
$450.00
RC203893L3 Lenti ORF clone of Human nescient helix loop helix 1 (NHLH1), Myc-DDK-tagged 10 ug
$450.00
RC203893L4 Lenti ORF clone of Human nescient helix loop helix 1 (NHLH1), mGFP tagged 10 ug
$450.00
RG203893 NHLH1 (tGFP-tagged) - Human nescient helix loop helix 1 (NHLH1) 10 ug
$489.00
SC122722 NHLH1 (untagged)-Human nescient helix loop helix 1 (NHLH1) 10 ug
$150.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.