Stefin B (CSTB) (NM_000100) Human Tagged ORF Clone

SKU
RC203872
CSTB (Myc-DDK-tagged)-Human cystatin B (stefin B) (CSTB)
  • TrueORF Gold

    Protein expression verified by Western blot, fully sequenced and in stock

    Click here to learn more.

$225.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol Stefin B
Synonyms CPI-B; CST6; EPM1; EPM1A; PME; STFB; ULD
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC203872 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGATGTGCGGGGCGCCCTCCGCCACGCAGCCGGCCACCGCCGAGACCCAGCACATCGCCGACCAGGTGA
GGTCCCAGCTTGAAGAGAAAGAAAACAAGAAGTTCCCTGTGTTTAAGGCCGTGTCATTCAAGAGCCAGGT
GGTCGCGGGGACAAACTACTTCATCAAGGTGCACGTCGGCGACGAGGACTTCGTACACCTGCGAGTGTTC
CAATCTCTCCCTCATGAAAACAAGCCCTTGACCTTATCTAACTACCAGACCAACAAAGCCAAGCATGATG
AGCTGACCTATTTC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC203872 protein sequence
Red=Cloning site Green=Tags(s)

MMCGAPSATQPATAETQHIADQVRSQLEEKENKKFPVFKAVSFKSQVVAGTNYFIKVHVGDEDFVHLRVF
QSLPHENKPLTLSNYQTNKAKHDELTYF

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_000100
ORF Size 294 bp
OTI Disclaimer Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery.

The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_000100.4
RefSeq Size 940 bp
RefSeq ORF 297 bp
Locus ID 1476
UniProt ID P04080
Cytogenetics 21q22.3
Domains CY
MW 11.1 kDa
Summary The cystatin superfamily encompasses proteins that contain multiple cystatin-like sequences. Some of the members are active cysteine protease inhibitors, while others have lost or perhaps never acquired this inhibitory activity. There are three inhibitory families in the superfamily, including the type 1 cystatins (stefins), type 2 cystatins and kininogens. This gene encodes a stefin that functions as an intracellular thiol protease inhibitor. The protein is able to form a dimer stabilized by noncovalent forces, inhibiting papain and cathepsins l, h and b. The protein is thought to play a role in protecting against the proteases leaking from lysosomes. Evidence indicates that mutations in this gene are responsible for the primary defects in patients with progressive myoclonic epilepsy (EPM1). One type of mutation responsible for EPM1 is the expansion in the promoter region of this gene of a CCCCGCCCCGCG repeat from 2-3 copies to 30-78 copies. [provided by RefSeq, Jul 2016]
Write Your Own Review
You're reviewing:Stefin B (CSTB) (NM_000100) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC203872L1 Lenti ORF clone of Human cystatin B (stefin B) (CSTB), Myc-DDK-tagged 10 ug
$525.00
RC203872L2 Lenti ORF clone of Human cystatin B (stefin B) (CSTB), mGFP tagged 10 ug
$525.00
RC203872L3 Lenti ORF clone of Human cystatin B (stefin B) (CSTB), Myc-DDK-tagged 10 ug
$525.00
RC203872L4 Lenti ORF clone of Human cystatin B (stefin B) (CSTB), mGFP tagged 10 ug
$525.00
RG203872 CSTB (tGFP-tagged) - Human cystatin B (stefin B) (CSTB) 10 ug
$425.00
SC100002 CSTB (untagged)-Human cystatin B (stefin B) (CSTB) 10 ug
$225.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.