NORE1 (RASSF5) (NM_182665) Human Tagged ORF Clone

SKU
RC203854
RASSF5 (Myc-DDK-tagged)-Human Ras association (RalGDS/AF-6) domain family member 5 (RASSF5), transcript variant 3
  • TrueORF Gold

    Protein expression verified by Western blot, fully sequenced and in stock

    Click here to learn more.

$300.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol NORE1
Synonyms Maxp1; NORE1; NORE1A; NORE1B; RAPL; RASSF3
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC203854 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGACCGTGGACAGCAGCATGAGCAGTGGGTACTGCAGCCTGGACGAGGAACTGGAAGACTGCTTCTTCA
CTGCTAAGACTACCTTTTTCAGAAATGCGCAGAGCAAACATCTTTCAAAGAATGTCTGTAAACCTGTGGA
GGAGACACAGCGCCCGCCCACACTGCAGGAGATCAAGCAGAAGATCGACAGCTACAACACGCGAGAGAAG
AACTGCCTGGGCATGAAACTGAGTGAAGACGGCACCTACACGGGTTTCATCAAAGTGCATCTGAAACTCC
GGCGGCCTGTGACGGTGCCTGCTGGGATCCGGCCCCAGTCCATCTATGATGCCATCAAGGAGGTGAACCT
GGCGGCTACCACGGACAAGCGGACATCCTTCTACCTGCCCCTAGATGCCATCAAGCAGCTGCACATCAGC
AGCACCACCACCGTCAGTGAGGTCATCCAGGGGCTGCTCAAGAAGTTCATGGTTGTGGACAATCCCCAGA
AGTTTGCACTTTTTAAGCGGATACACAAGGACGGACAAGTGCTCTTCCAGAAACTCTCCATTGCTGACCG
CCCCCTCTACCTGCGCCTGCTTGCTGGGCCTGACACGGAGGTCCTCAGCTTTGTGCTAAAGGAGAATGAA
ACTGGAGAGGTAGAGTGGGATGCCTTCTCCATCCCTGAACTTCAGAACTTCCTAACAATCCTGGAAAAAG
AGGAGCAGGACAAAATCCAACAAGTGCAAAAGAAGTATGACAAGTTTAGGCAGAAACTGGAGGAGGCCTT
AAGAGAATCCCAGGGCAAACCTGGG


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC203854 protein sequence
Red=Cloning site Green=Tags(s)

MTVDSSMSSGYCSLDEELEDCFFTAKTTFFRNAQSKHLSKNVCKPVEETQRPPTLQEIKQKIDSYNTREK
NCLGMKLSEDGTYTGFIKVHLKLRRPVTVPAGIRPQSIYDAIKEVNLAATTDKRTSFYLPLDAIKQLHIS
STTTVSEVIQGLLKKFMVVDNPQKFALFKRIHKDGQVLFQKLSIADRPLYLRLLAGPDTEVLSFVLKENE
TGEVEWDAFSIPELQNFLTILEKEEQDKIQQVQKKYDKFRQKLEEALRESQGKPG

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_182665
ORF Size 795 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_182665.4
RefSeq Size 3531 bp
RefSeq ORF 798 bp
Locus ID 83593
UniProt ID Q8WWW0
Cytogenetics 1q32.1
Protein Families Druggable Genome
Protein Pathways Leukocyte transendothelial migration, Non-small cell lung cancer, Pathways in cancer
MW 30.4 kDa
Summary This gene is a member of the Ras association domain family. It functions as a tumor suppressor, and is inactivated in a variety of cancers. The encoded protein localizes to centrosomes and microtubules, and associates with the GTP-activated forms of Ras, Rap1, and several other Ras-like small GTPases. The protein regulates lymphocyte adhesion and suppresses cell growth in response to activated Rap1 or Ras. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2008]
Write Your Own Review
You're reviewing:NORE1 (RASSF5) (NM_182665) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC203854L1 Lenti ORF clone of Human Ras association (RalGDS/AF-6) domain family member 5 (RASSF5), transcript variant 3, Myc-DDK-tagged 10 ug
$600.00
RC203854L2 Lenti ORF clone of Human Ras association (RalGDS/AF-6) domain family member 5 (RASSF5), transcript variant 3, mGFP tagged 10 ug
$600.00
RC203854L3 Lenti ORF clone of Human Ras association (RalGDS/AF-6) domain family member 5 (RASSF5), transcript variant 3, Myc-DDK-tagged 10 ug
$600.00
RC203854L4 Lenti ORF clone of Human Ras association (RalGDS/AF-6) domain family member 5 (RASSF5), transcript variant 3, mGFP tagged 10 ug
$600.00
RG203854 RASSF5 (tGFP-tagged) - Human Ras association (RalGDS/AF-6) domain family member 5 (RASSF5), transcript variant 3 10 ug
$489.00 MSRP $500.00 MSRP $500.00
SC107439 RASSF5 (untagged)-Human Ras association (RalGDS/AF-6) domain family member 5 (RASSF5), transcript variant 3 10 ug
$1,024.00
SC324315 RASSF5 (untagged)-Human Ras association (RalGDS/AF-6) domain family member 5 (RASSF5), transcript variant 3 10 ug
$300.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.