BORCS5 (NM_058169) Human Tagged ORF Clone

CAT#: RC203844

Reviews ()
Write a review

LOH12CR1 (Myc-DDK-tagged)-Human loss of heterozygosity, 12, chromosomal region 1 (LOH12CR1)



Reconstitution Protocol

Special Offer: 20% off the control vector (empty cloning vector without insert). Use code "Shuttle20".

USD 118.00

USD 429.00


Availability*
In Stock

Size
    • 10 ug


Product images

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol BORCS5
Synonyms LOH1CR12; LOH12CR1
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC203844 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGGCAGTGAGCAGAGCTCCGAGGCCGAGAGCCGACCCAACGATCTGAACTCCTCAGTGACTCCTTCAC
CAGCCAAGCATAGAGCCAAGATGGATGATATTGTGGTTGTAGCTCAGGGCTCCCAGGCCTCACGGAACGT
CAGCAACGATCCCGATGTCATCAAGTTGCAAGAGATTCCAACCTTCCAGCCCCTTTTGAAAGGGCTATTG
AGTGGCCAGACTTCCCCAACAAATGCCAAATTGGAGAAACTGGACTCTCAGCAGGTGTTGCAGCTCTGCC
TCCGATATCAAGATCACCTGCATCAGTGTGCAGAGGCCGTTGCTTTTGACCAGAATGCTTTGGTTAAACG
AATCAAAGAGATGGATCTGTCTGTAGAAACTCTGTTCAGCTTCATGCAGGAGCGCCAGAAAAGATACGCC
AAGTATGCCGAGCAGATCCAGAAAGTGAACGAGATGTCCGCCATCCTCCGCCGCATACAGATGGGCATCG
ACCAGACTGTGCCCCTGCTGGACAGGCTCAACAGCATGCTGCCCGAGGGCGAGCGGCTGGAGCCCTTCAG
CATGAAGCCCGACCGCGAGCTCAGGCTG


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC203844 protein sequence
Red=Cloning site Green=Tags(s)

MGSEQSSEAESRPNDLNSSVTPSPAKHRAKMDDIVVVAQGSQASRNVSNDPDVIKLQEIPTFQPLLKGLL
SGQTSPTNAKLEKLDSQQVLQLCLRYQDHLHQCAEAVAFDQNALVKRIKEMDLSVETLFSFMQERQKRYA
KYAEQIQKVNEMSAILRRIQMGIDQTVPLLDRLNSMLPEGERLEPFSMKPDRELRL

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_058169
ORF Size 588 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_058169.6
RefSeq Size 2092 bp
RefSeq ORF 591 bp
Locus ID 118426
UniProt ID Q969J3
Cytogenetics 12p13.2
MW 22.2 kDa
Gene Summary As part of the BORC complex may play a role in lysosomes movement and localization at the cell periphery. Associated with the cytosolic face of lysosomes, the BORC complex may recruit ARL8B and couple lysosomes to microtubule plus-end-directed kinesin motor. Thereby, it may indirectly play a role in cell spreading and motility.[UniProtKB/Swiss-Prot Function]
Other products for "BORCS5"
Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.