MRAP2 (NM_138409) Human Tagged ORF Clone

SKU
RC203668
MRAP2 (Myc-DDK-tagged)-Human melanocortin 2 receptor accessory protein 2 (MRAP2)
  • TrueORF Gold

    Protein expression verified by Western blot, fully sequenced and in stock

    Click here to learn more.

$300.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol MRAP2
Synonyms bA51G5.2; C6orf117
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC203668 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGTCCGCCCAGAGGTTAATTTCTAACAGAACCTCCCAGCAATCGGCATCTAATTCTGATTACACCTGGG
AATATGAATATTATGAGATTGGACCAGTTTCCTTTGAAGGACTGAAGGCTCATAAATATTCCATTGTGAT
TGGATTTTGGGTTGGTCTTGCAGTCTTCGTGATTTTTATGTTTTTTGTGCTGACCTTGCTGACCAAGACA
GGAGCCCCACACCAAGACAATGCAGAGTCCTCAGAGAAGAGATTCAGAATGAACAGCTTTGTGTCAGACT
TTGGAAGACCTCTGGAGCCAGATAAAGTATTTTCTCGCCAAGGCAACGAGGAGTCCAGGTCTCTCTTTCA
CTGCTACATCAATGAGGTGGAACGCTTGGACAGAGCCAAAGCTTGTCACCAGACCACAGCCCTTGACAGT
GACGTCCAACTCCAGGAAGCCATCAGAAGCAGTGGGCAGCCAGAGGAGGAGCTGAACAGGCTCATGAAGT
TTGACATCCCCAACTTTGTGAACACAGACCAGAACTACTTTGGGGAGGATGATCTTCTGATTTCTGAACC
ACCTATTGTTCTGGAAACTAAGCCACTTTCCCAGACCTCACACAAAGACCTGGAT


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC203668 protein sequence
Red=Cloning site Green=Tags(s)

MSAQRLISNRTSQQSASNSDYTWEYEYYEIGPVSFEGLKAHKYSIVIGFWVGLAVFVIFMFFVLTLLTKT
GAPHQDNAESSEKRFRMNSFVSDFGRPLEPDKVFSRQGNEESRSLFHCYINEVERLDRAKACHQTTALDS
DVQLQEAIRSSGQPEEELNRLMKFDIPNFVNTDQNYFGEDDLLISEPPIVLETKPLSQTSHKDLD

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_138409
ORF Size 615 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_138409.4
RefSeq Size 2229 bp
RefSeq ORF 618 bp
Locus ID 112609
UniProt ID Q96G30
Cytogenetics 6q14.2
Protein Families Transmembrane
MW 23.5 kDa
Summary This gene encodes a protein that modulates melanocortin receptor signaling. The encoded protein has been shown to interact with all known melanocortin receptors and may regulate both receptor trafficking and activation in response to ligands. Mice lacking a functional copy of this gene exhibit severe obesity and a mutation in this gene may be associated with severe obesity in human patients. [provided by RefSeq, Oct 2016]
Write Your Own Review
You're reviewing:MRAP2 (NM_138409) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC203668L1 Lenti ORF clone of Human melanocortin 2 receptor accessory protein 2 (MRAP2), Myc-DDK-tagged 10 ug
$600.00
RC203668L2 Lenti ORF clone of Human melanocortin 2 receptor accessory protein 2 (MRAP2), mGFP tagged 10 ug
$600.00
RC203668L3 Lenti ORF clone of Human melanocortin 2 receptor accessory protein 2 (MRAP2), Myc-DDK-tagged 10 ug
$600.00
RC203668L4 Lenti ORF clone of Human melanocortin 2 receptor accessory protein 2 (MRAP2), mGFP tagged 10 ug
$600.00
RG203668 MRAP2 (tGFP-tagged) - Human melanocortin 2 receptor accessory protein 2 (MRAP2) 10 ug
$489.00 MSRP $500.00 MSRP $500.00
SC100506 MRAP2 (untagged)-Human melanocortin 2 receptor accessory protein 2 (MRAP2) 10 ug
$300.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.