APH1A (NM_016022) Human Tagged ORF Clone

SKU
RC203645
APH1A (Myc-DDK-tagged)-Human anterior pharynx defective 1 homolog A (C. elegans) (APH1A), transcript variant 2
  • TrueORF Gold

    Protein expression verified by Western blot, fully sequenced and in stock

    Click here to learn more.

$450.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol APH1A
Synonyms 6530402N02Rik; APH-1; APH-1A; CGI-78
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC203645 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGGGGCTGCGGTGTTTTTCGGCTGCACTTTCGTCGCGTTCGGCCCGGCCTTCGCGCTTTTCTTGATCA
CTGTGGCTGGGGACCCGCTTCGCGTTATCATCCTGGTCGCAGGGGCATTTTTCTGGCTGGTCTCCCTGCT
CCTGGCCTCTGTGGTCTGGTTCATCTTGGTCCATGTGACCGACCGGTCAGATGCCCGGCTCCAGTACGGC
CTCCTGATTTTTGGTGCTGCTGTCTCTGTCCTTCTACAGGAGGTGTTCCGCTTTGCCTACTACAAGCTGC
TTAAGAAGGCAGATGAGGGGTTAGCATCGCTGAGTGAGGACGGAAGATCACCCATCTCCATCCGCCAGAT
GGCCTATGTTTCTGGTCTCTCCTTCGGTATCATCAGTGGTGTCTTCTCTGTTATCAATATTTTGGCTGAT
GCACTTGGGCCAGGTGTGGTTGGGATCCATGGAGACTCACCCTATTACTTCCTGACTTCAGCCTTTCTGA
CAGCAGCCATTATCCTGCTCCATACCTTTTGGGGAGTTGTGTTCTTTGATGCCTGTGAGAGGAGACGGTA
CTGGGCTTTGGGCCTGGTGGTTGGGAGTCACCTACTGACATCGGGACTGACATTCCTGAACCCCTGGTAT
GAGGCCAGCCTGCTGCCCATCTATGCAGTCACTGTTTCCATGGGGCTCTGGGCCTTCATCACAGCTGGAG
GGTCCCTCCGAAGTATTCAGCGCAGCCTCTTGTGTAAGGAC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC203645 protein sequence
Red=Cloning site Green=Tags(s)

MGAAVFFGCTFVAFGPAFALFLITVAGDPLRVIILVAGAFFWLVSLLLASVVWFILVHVTDRSDARLQYG
LLIFGAAVSVLLQEVFRFAYYKLLKKADEGLASLSEDGRSPISIRQMAYVSGLSFGIISGVFSVINILAD
ALGPGVVGIHGDSPYYFLTSAFLTAAIILLHTFWGVVFFDACERRRYWALGLVVGSHLLTSGLTFLNPWY
EASLLPIYAVTVSMGLWAFITAGGSLRSIQRSLLCKD

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_016022
ORF Size 741 bp
OTI Disclaimer Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery.

The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_016022.3
RefSeq Size 2290 bp
RefSeq ORF 744 bp
Locus ID 51107
UniProt ID Q96BI3
Cytogenetics 1q21.2
Protein Families Druggable Genome, ES Cell Differentiation/IPS, Transmembrane
Protein Pathways Alzheimer's disease, Notch signaling pathway
MW 26.8 kDa
Summary This gene encodes a component of the gamma secretase complex that cleaves integral membrane proteins such as Notch receptors and beta-amyloid precursor protein. The gamma secretase complex contains this gene product, or the paralogous anterior pharynx defective 1 homolog B (APH1B), along with the presenilin, nicastrin, and presenilin enhancer-2 proteins. The precise function of this seven-transmembrane-domain protein is unknown though it is suspected of facilitating the association of nicastrin and presenilin in the gamma secretase complex as well as interacting with substrates of the gamma secretase complex prior to their proteolytic processing. Polymorphisms in a promoter region of this gene have been associated with an increased risk for developing sporadic Alzheimer's disease. Alternative splicing results in multiple protein-coding and non-protein-coding transcript variants. [provided by RefSeq, Aug 2011]
Write Your Own Review
You're reviewing:APH1A (NM_016022) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC203645L1 Lenti ORF clone of Human anterior pharynx defective 1 homolog A (C. elegans) (APH1A), transcript variant 2, Myc-DDK-tagged 10 ug
$750.00
RC203645L2 Lenti ORF clone of Human anterior pharynx defective 1 homolog A (C. elegans) (APH1A), transcript variant 2, mGFP tagged 10 ug
$750.00
RC203645L3 Lenti ORF clone of Human anterior pharynx defective 1 homolog A (C. elegans) (APH1A), transcript variant 2, Myc-DDK-tagged 10 ug
$750.00
RC203645L4 Lenti ORF clone of Human anterior pharynx defective 1 homolog A (C. elegans) (APH1A), transcript variant 2, mGFP tagged 10 ug
$750.00
RG203645 APH1A (tGFP-tagged) - Human anterior pharynx defective 1 homolog A (C. elegans) (APH1A), transcript variant 2 10 ug
$650.00
SC111265 APH1A (untagged)-Human anterior pharynx defective 1 homolog A (C. elegans) (APH1A), transcript variant 2 10 ug
$450.00
SC320360 APH1A (untagged)-Human anterior pharynx defective 1 homolog A (C. elegans) (APH1A), transcript variant 2 10 ug
$450.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.