XRCC6BP1 (ATP23) (NM_033276) Human Tagged ORF Clone

SKU
RC203623
XRCC6BP1 (Myc-DDK-tagged)-Human XRCC6 binding protein 1 (XRCC6BP1)
  • TrueORF Gold

    Protein expression verified by Western blot, fully sequenced and in stock

    Click here to learn more.

$300.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol XRCC6BP1
Synonyms KUB3; XRCC6BP1
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC203623 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCGGGAGCTCCGGACGAGCGCCGGCGGGGCCCCGCGGCAGGGGAGCAGCTGCAGCAGCAACACGTCT
CTTGCCAGGTCTTCCCCGAGCGTCTGGCCCAGGGGAATCCCCAGCAAGGGTTCTTCTCCAGCTTCTTCAC
CAGCAACCAGAAGTGCCAGCTTAGGCTCCTGAAGACGCTGGAGACAAATCCATATGTCAAACTTCTGCTT
GATGCTATGAAACACTCAGGTTGTGCTGTTAACAAAGATAGACACTTTTCTTGCGAAGACTGTAATGGAA
ATGTCAGTGGAGGTTTTGATGCTTCAACATCTCAGATAGTTTTGTGCCAGAATAATATCCATAATCAGGC
CCATATGAACAGAGTGGTCACACACGAGCTTATTCATGCATTTGATCATTGTCGTGCCCATGTCGACTGG
TTCACCAACATCAGACATTTGGCGTGCTCAGAGGTTCGAGCTGCTAACCTTAGTGGAGACTGCTCACTTG
TCAATGAAATATTCAGGTTACATTTTGGATTAAAACAACACCACCAGACTTGTGTGCGAGACAGAGCCAC
TCTTTCTATCCTGGCTGTTAGGAATATCAGCAAAGAAGTAGCTAAAAAGGCTGTTGATGAAGTTTTTGAA
TCTTGTTTCAATGACCATGAACCTTTTGGAAGGATCCCACATAACAAGACTTATGCAAGATATGCTCACA
GAGACTTTGAAAACCGTGATCGGTATTATTCAAATATA


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC203623 protein sequence
Red=Cloning site Green=Tags(s)

MAGAPDERRRGPAAGEQLQQQHVSCQVFPERLAQGNPQQGFFSSFFTSNQKCQLRLLKTLETNPYVKLLL
DAMKHSGCAVNKDRHFSCEDCNGNVSGGFDASTSQIVLCQNNIHNQAHMNRVVTHELIHAFDHCRAHVDW
FTNIRHLACSEVRAANLSGDCSLVNEIFRLHFGLKQHHQTCVRDRATLSILAVRNISKEVAKKAVDEVFE
SCFNDHEPFGRIPHNKTYARYAHRDFENRDRYYSNI

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_033276
ORF Size 738 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_033276.4
RefSeq Size 1182 bp
RefSeq ORF 741 bp
Locus ID 91419
UniProt ID Q9Y6H3
Cytogenetics 12q14.1
MW 28.1 kDa
Summary The protein encoded by this gene is amplified in glioblastomas and interacts with the DNA binding subunit of DNA-dependent protein kinase. This kinase is involved in double-strand break repair (DSB), and higher expression of the encoded protein increases the efficiency of DSB. In addition, comparison to orthologous proteins strongly suggests that this protein is a metalloprotease important in the biosynthesis of mitochondrial ATPase. Several transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Feb 2016]
Write Your Own Review
You're reviewing:XRCC6BP1 (ATP23) (NM_033276) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC203623L1 Lenti ORF clone of Human XRCC6 binding protein 1 (XRCC6BP1), Myc-DDK-tagged 10 ug
$600.00
RC203623L2 Lenti ORF clone of Human XRCC6 binding protein 1 (XRCC6BP1), mGFP tagged 10 ug
$600.00
RC203623L3 Lenti ORF clone of Human XRCC6 binding protein 1 (XRCC6BP1), Myc-DDK-tagged 10 ug
$600.00
RC203623L4 Lenti ORF clone of Human XRCC6 binding protein 1 (XRCC6BP1), mGFP tagged 10 ug
$600.00
RG203623 XRCC6BP1 (tGFP-tagged) - Human XRCC6 binding protein 1 (XRCC6BP1) 10 ug
$489.00 MSRP $500.00 MSRP $500.00
SC123084 XRCC6BP1 (untagged)-Human XRCC6 binding protein 1 (XRCC6BP1) 10 ug
$300.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.