TCEAL3 (NM_001006933) Human Tagged ORF Clone

SKU
RC203524
TCEAL3 (Myc-DDK-tagged)-Human transcription elongation factor A (SII)-like 3 (TCEAL3), transcript variant 1
  • TrueORF Gold

    Protein expression verified by Western blot, fully sequenced and in stock

    Click here to learn more.

$300.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol TCEAL3
Synonyms WEX8
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC203524 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGAAAAACCCTACAATAAAAATGAAGGAAACCTGGAAAACGAGGGAAAGCCAGAAGATGAAGTAGAGC
CTGATGATGAAGGAAAGTCAGACGAGGAAGAAAAGCCAGACGTGGAGGGGAAGACAGAATGCGAGGGAAA
GAGAGAGGATGAGGGAGAGCCAGGTGATGAGGGACAACTGGAAGATGAGGGAAGCCAGGAAAAGCAGGGC
AGGTCCGAAGGTGAGGGCAAGCCACAAGGCGAGGGCAAGCCAGCCTCCCAGGCAAAGCCAGAGAGCCAGC
CGCGGGCCGCCGAAAAGCGCCCGGCTGAAGATTATGTGCCCCGGAAAGCAAAAAGAAAAACGGACAGGGG
GACGGACGATTCCCCCAAGGACTCTCAGGAGGACTTACAGGAAAGGCATCTGAGCAGTGAGGAGATGATG
AGAGAATGTGGAGATGTGTCAAGGGCTCAAGAGGAGCTAAGGAAAAAACAGAAAATGGGTGGTTTTCATT
GGATGCAAAGAGATGTACAGGATCCATTCGCCCCAAGGGGACAACGGGGTGTCAGGGGAGTGAGGGGTGG
AGGTAGGGGCCAGAGGGGCTTACACGATATCCCATACCTT


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC203524 protein sequence
Red=Cloning site Green=Tags(s)

MEKPYNKNEGNLENEGKPEDEVEPDDEGKSDEEEKPDVEGKTECEGKREDEGEPGDEGQLEDEGSQEKQG
RSEGEGKPQGEGKPASQAKPESQPRAAEKRPAEDYVPRKAKRKTDRGTDDSPKDSQEDLQERHLSSEEMM
RECGDVSRAQEELRKKQKMGGFHWMQRDVQDPFAPRGQRGVRGVRGGGRGQRGLHDIPYL

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_001006933
ORF Size 600 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_001006933.1, NP_001006934.1
RefSeq Size 1154 bp
RefSeq ORF 603 bp
Locus ID 85012
UniProt ID Q969E4
Cytogenetics Xq22.2
MW 22.5 kDa
Summary This gene encodes a member of the transcription elongation factor A (SII)-like (TCEAL) gene family. Members of this family contain TFA domains and may function as nuclear phosphoproteins that modulate transcription in a promoter context-dependent manner. Multiple family members are located on the X chromosome. Alternative splicing results in multiple transcript variants encoding a single isoform. [provided by RefSeq, Jul 2008]
Write Your Own Review
You're reviewing:TCEAL3 (NM_001006933) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC203524L3 Lenti ORF clone of Human transcription elongation factor A (SII)-like 3 (TCEAL3), transcript variant 1, Myc-DDK-tagged 10 ug
$600.00
RC203524L4 Lenti ORF clone of Human transcription elongation factor A (SII)-like 3 (TCEAL3), transcript variant 1, mGFP tagged 10 ug
$600.00
RG203524 TCEAL3 (tGFP-tagged) - Human transcription elongation factor A (SII)-like 3 (TCEAL3), transcript variant 1 10 ug
$500.00
SC319199 TCEAL3 (untagged)-Human transcription elongation factor A (SII)-like 3 (TCEAL3), transcript variant 1 10 ug
$300.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.