RRAGA (NM_006570) Human Tagged ORF Clone

SKU
RC203493
RRAGA (Myc-DDK-tagged)-Human Ras-related GTP binding A (RRAGA)
  • TrueORF Gold

    Protein expression verified by Western blot, fully sequenced and in stock

    Click here to learn more.

$450.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol RRAGA
Synonyms FIP-1; FIP1; RAGA
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC203493 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGCCAAATACAGCCATGAAGAAAAAGGTGCTGCTGATGGGGAAGAGCGGGTCGGGGAAGACCAGCATGA
GGTCGATAATCTTCGCCAATTACATTGCTCGCGACACCCGGCGCCTGGGGGCCACCATTGACGTGGAACA
CTCCCACGTCCGATTCCTAGGGAACCTGGTGCTGAACCTGTGGGACTGTGGCGGTCAGGACACCTTCATG
GAAAATTACTTCACCAGCCAGCGAGACAATATCTTCCGTAACGTGGAAGTTTTGATTTACGTGTTTGACG
TGGAGAGCCGCGAACTGGAAAAGGACATGCATTATTACCAGTCGTGTCTGGAGGCCATCCTCCAGAACTC
TCCTGACGCCAAAATCTTCTGCCTGGTGCACAAAATGGATCTGGTTCAGGAGGATCAGCGTGACCTGATT
TTTAAAGAGCGAGAGGAAGACCTGAGGCGTCTGTCTCGCCCGCTGGAGTGTGCTTGTTTTCGAACGTCCA
TCTGGGATGAGACGCTCTACAAAGCCTGGTCCAGCATCGTCTACCAGCTGATTCCCAACGTTCAGCAGCT
GGAGATGAACCTCAGGAATTTTGCCCAAATCATTGAGGCCGATGAAGTTCTGCTGTTCGAAAGAGCTACA
TTCTTGGTTATTTCCCACTACCAGTGCAAAGAGCAGCGCGACGTCCACCGGTTTGAGAAGATCAGCAACA
TCATCAAACAGTTCAAGCTGAGCTGCAGTAAATTGGCCGCTTCCTTCCAGAGCATGGAAGTTAGGAATTC
CAACTTCGCTGCTTTCATCGACATCTTCACCTCAAATACGTACGTGATGGTGGTCATGTCAGATCCGTCG
ATCCCTTCTGCGGCCACTCTGATCAACATTCGCAATGCCCGGAAACACTTTGAGAAGCTGGAGAGAGTGG
ATGGCCCCAAGCACAGTCTCCTTATGCGT


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC203493 protein sequence
Red=Cloning site Green=Tags(s)

MPNTAMKKKVLLMGKSGSGKTSMRSIIFANYIARDTRRLGATIDVEHSHVRFLGNLVLNLWDCGGQDTFM
ENYFTSQRDNIFRNVEVLIYVFDVESRELEKDMHYYQSCLEAILQNSPDAKIFCLVHKMDLVQEDQRDLI
FKEREEDLRRLSRPLECACFRTSIWDETLYKAWSSIVYQLIPNVQQLEMNLRNFAQIIEADEVLLFERAT
FLVISHYQCKEQRDVHRFEKISNIIKQFKLSCSKLAASFQSMEVRNSNFAAFIDIFTSNTYVMVVMSDPS
IPSAATLINIRNARKHFEKLERVDGPKHSLLMR

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_006570
ORF Size 939 bp
OTI Disclaimer Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery.

The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_006570.5
RefSeq Size 1657 bp
RefSeq ORF 942 bp
Locus ID 10670
UniProt ID Q7L523
Cytogenetics 9p22.1
Domains Gtr1_RagA
MW 36.6 kDa
Summary Guanine nucleotide-binding protein that plays a crucial role in the cellular response to amino acid availability through regulation of the mTORC1 signaling cascade. Forms heterodimeric Rag complexes with RRAGC or RRAGD and cycles between an inactive GDP-bound and an active GTP-bound form. In its active form participates in the relocalization of mTORC1 to the lysosomes and its subsequent activation by the GTPase RHEB. Involved in the RCC1/Ran-GTPase pathway. May play a direct role in a TNF-alpha signaling pathway leading to induction of cell death. May alternatively act as a cellular target for adenovirus E3-14.7K, an inhibitor of TNF-alpha functions, thereby affecting cell death.[UniProtKB/Swiss-Prot Function]
Write Your Own Review
You're reviewing:RRAGA (NM_006570) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC203493L1 Lenti ORF clone of Human Ras-related GTP binding A (RRAGA), Myc-DDK-tagged 10 ug
$750.00
RC203493L2 Lenti ORF clone of Human Ras-related GTP binding A (RRAGA), mGFP tagged 10 ug
$750.00
RC203493L3 Lenti ORF clone of Human Ras-related GTP binding A (RRAGA), Myc-DDK-tagged 10 ug
$750.00
RC203493L4 Lenti ORF clone of Human Ras-related GTP binding A (RRAGA), mGFP tagged 10 ug
$750.00
RG203493 RRAGA (tGFP-tagged) - Human Ras-related GTP binding A (RRAGA) 10 ug
$650.00
SC116000 RRAGA (untagged)-Human Ras-related GTP binding A (RRAGA) 10 ug
$450.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.