Syndecan 2 (SDC2) (NM_002998) Human Tagged ORF Clone

SKU
RC203366
SDC2 (Myc-DDK-tagged)-Human syndecan 2 (SDC2)
  • TrueORF Gold

    Protein expression verified by Western blot, fully sequenced and in stock

    Click here to learn more.

$300.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol Syndecan 2
Synonyms CD362; HSPG; HSPG1; SYND2
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC203366 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGCGGCGCGCGTGGATCCTGCTCACCTTGGGCTTGGTGGCCTGCGTGTCGGCGGAGTCGAGAGCAGAGC
TGACATCTGATAAAGACATGTACCTTGACAACAGCTCCATTGAAGAAGCTTCAGGAGTGTATCCTATTGA
TGACGATGACTACGCTTCTGCGTCTGGCTCGGGAGCTGATGAGGATGTAGAGAGTCCAGAGCTGACAACA
TCTCGACCACTTCCAAAGATACTGTTGACTAGTGCTGCTCCAAAAGTGGAAACCACGACGCTGAATATAC
AGAACAAGATACCTGCTCAGACAAAGTCACCTGAAGAAACTGATAAAGAGAAAGTTCACCTCTCTGACTC
AGAAAGGAAAATGGACCCAGCCGAAGAGGATACAAATGTGTATACTGAGAAACACTCAGACAGTCTGTTT
AAACGGACAGAAGTCCTAGCAGCTGTCATTGCTGGTGGAGTTATTGGCTTTCTCTTTGCAATTTTTCTTA
TCCTGCTGTTGGTGTATCGCATGAGAAAGAAGGATGAAGGAAGCTATGACCTTGGAGAACGCAAACCATC
CAGTGCTGCTTATCAGAAGGCACCTACTAAGGAGTTTTATGCG


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC203366 protein sequence
Red=Cloning site Green=Tags(s)

MRRAWILLTLGLVACVSAESRAELTSDKDMYLDNSSIEEASGVYPIDDDDYASASGSGADEDVESPELTT
SRPLPKILLTSAAPKVETTTLNIQNKIPAQTKSPEETDKEKVHLSDSERKMDPAEEDTNVYTEKHSDSLF
KRTEVLAAVIAGGVIGFLFAIFLILLLVYRMRKKDEGSYDLGERKPSSAAYQKAPTKEFYA

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_002998
ORF Size 603 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_002998.4
RefSeq Size 3485 bp
RefSeq ORF 606 bp
Locus ID 6383
UniProt ID P34741
Cytogenetics 8q22.1
Protein Families Druggable Genome, Transmembrane
Protein Pathways Cell adhesion molecules (CAMs), ECM-receptor interaction
MW 22.2 kDa
Summary The protein encoded by this gene is a transmembrane (type I) heparan sulfate proteoglycan and is a member of the syndecan proteoglycan family. The syndecans mediate cell binding, cell signaling, and cytoskeletal organization and syndecan receptors are required for internalization of the HIV-1 tat protein. The syndecan-2 protein functions as an integral membrane protein and participates in cell proliferation, cell migration and cell-matrix interactions via its receptor for extracellular matrix proteins. Altered syndecan-2 expression has been detected in several different tumor types. [provided by RefSeq, Jul 2008]
Write Your Own Review
You're reviewing:Syndecan 2 (SDC2) (NM_002998) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC203366L1 Lenti ORF clone of Human syndecan 2 (SDC2), Myc-DDK-tagged 10 ug
$600.00
RC203366L2 Lenti ORF clone of Human syndecan 2 (SDC2), mGFP tagged 10 ug
$600.00
RC203366L3 Lenti ORF clone of Human syndecan 2 (SDC2), Myc-DDK-tagged 10 ug
$600.00
RC203366L4 Lenti ORF clone of Human syndecan 2 (SDC2), mGFP tagged 10 ug
$600.00
RG203366 SDC2 (tGFP-tagged) - Human syndecan 2 (SDC2) 10 ug
$489.00 MSRP $500.00 MSRP $500.00
SC111011 SDC2 (untagged)-Human syndecan 2 (SDC2) 10 ug
$300.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.