NDUFS7 (NM_024407) Human Tagged ORF Clone

SKU
RC203279
NDUFS7 (Myc-DDK-tagged)-Human NADH dehydrogenase (ubiquinone) Fe-S protein 7, 20kDa (NADH-coenzyme Q reductase) (NDUFS7), nuclear gene encoding mitochondrial protein
  • TrueORF Gold

    Protein expression verified by Western blot, fully sequenced and in stock

    Click here to learn more.

$300.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol NDUFS7
Synonyms CI-20; CI-20KD; MC1DN3; MY017; PSST
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC203279 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCGGTGCTGTCAGCTCCTGGCCTGCGCGGCTTCCGGATCCTTGGTCTGCGCTCCAGCGTGGGCCTGG
CTGTGCAGGCACGAGGTGTCCATCAGAGCGTGGCCACCGATGGCCCAAGCAGCACCCAGCCTGCCCTGCC
AAAGGCCAGAGCCGTGGCTCCCAAACCCAGCAGCCGGGGCGAGTATGTGGTGGCCAAGCTGGATGACCTC
GTCAACTGGGCCCGCCGGAGTTCTCTGTGGCCCATGACCTTCGGCCTGGCCTGCTGCGCCGTGGAGATGA
TGCACATGGCAGCACCCCGCTACGACATGGACCGCTTTGGCGTGGTCTTCCGCGCCAGCCCGCGCCAGTC
CGACGTCATGATCGTGGCCGGCACACTCACCAACAAGATGGCCCCAGCGCTTCGCAAGGTCTACGACCAG
ATGCCGGAGCCGCGCTACGTGGTCTCCATGGGGAGCTGCGCCAACGGAGGAGGCTACTACCACTATTCCT
ACTCGGTGGTGAGGGGCTGCGACCGCATCGTGCCCGTGGACATCTACATCCCAGGCTGCCCACCTACGGC
CGAGGCCCTGCTCTACGGCATCCTGCAGCTGCAGAGGAAGATCAAGCGGGAGCGGAGGCTGCAGATCTGG
TACCGCAGG


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC203279 protein sequence
Red=Cloning site Green=Tags(s)

MAVLSAPGLRGFRILGLRSSVGLAVQARGVHQSVATDGPSSTQPALPKARAVAPKPSSRGEYVVAKLDDL
VNWARRSSLWPMTFGLACCAVEMMHMAAPRYDMDRFGVVFRASPRQSDVMIVAGTLTNKMAPALRKVYDQ
MPEPRYVVSMGSCANGGGYYHYSYSVVRGCDRIVPVDIYIPGCPPTAEALLYGILQLQRKIKRERRLQIW
YRR

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_024407
ORF Size 639 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_024407.3, NP_077718.2
RefSeq Size 799 bp
RefSeq ORF 642 bp
Locus ID 374291
UniProt ID O75251
Cytogenetics 19p13.3
Domains oxidored_q6
Protein Pathways Alzheimer's disease, Huntington's disease, Metabolic pathways, Oxidative phosphorylation, Parkinson's disease
MW 23.6 kDa
Summary This gene encodes a protein that is a subunit of one of the complexes that forms the mitochondrial respiratory chain. This protein is one of over 40 subunits found in complex I, the nicotinamide adenine dinucleotide (NADH):ubiquinone oxidoreductase. This complex functions in the transfer of electrons from NADH to the respiratory chain, and ubiquinone is believed to be the immediate electron acceptor for the enzyme. Mutations in this gene cause Leigh syndrome due to mitochondrial complex I deficiency, a severe neurological disorder that results in bilaterally symmetrical necrotic lesions in subcortical brain regions. [provided by RefSeq, Jul 2008]
Write Your Own Review
You're reviewing:NDUFS7 (NM_024407) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC203279L3 Lenti ORF clone of Human NADH dehydrogenase (ubiquinone) Fe-S protein 7, 20kDa (NADH-coenzyme Q reductase) (NDUFS7), nuclear gene encoding mitochondrial protein, Myc-DDK-tagged 10 ug
$600.00
RC203279L4 Lenti ORF clone of Human NADH dehydrogenase (ubiquinone) Fe-S protein 7, 20kDa (NADH-coenzyme Q reductase) (NDUFS7), nuclear gene encoding mitochondrial protein, mGFP tagged 10 ug
$600.00
RG203279 NDUFS7 (tGFP-tagged) - Human NADH dehydrogenase (ubiquinone) Fe-S protein 7, 20kDa (NADH-coenzyme Q reductase) (NDUFS7), nuclear gene encoding mitochondrial protein 10 ug
$489.00 MSRP $500.00 MSRP $500.00
SC108125 NDUFS7 (untagged)-Human NADH dehydrogenase (ubiquinone) Fe-S protein 7, 20kDa (NADH-coenzyme Q reductase) (NDUFS7), nuclear gene encoding mitochondrial protein 10 ug
$300.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.