PPT1 (NM_000310) Human Tagged ORF Clone

SKU
RC203278
PPT1 (Myc-DDK-tagged)-Human palmitoyl-protein thioesterase 1 (PPT1), transcript variant 1
  • TrueORF Gold

    Protein expression verified by Western blot, fully sequenced and in stock

    Click here to learn more.

$300.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol PPT1
Synonyms CLN1; INCL; PPT
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC203278 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCGTCGCCCGGCTGCCTGTGGCTCTTGGCTGTGGCTCTCCTGCCATGGACCTGCGCTTCTCGGGCGC
TGCAGCATCTGGACCCGCCGGCGCCGCTGCCGTTGGTGATCTGGCATGGGATGGGAGACAGCTGTTGCAA
TCCCTTAAGCATGGGTGCTATTAAAAAAATGGTGGAGAAGAAAATACCTGGAATTTACGTCTTATCTTTA
GAGATTGGGAAGACCCTGATGGAGGACGTGGAGAACAGCTTCTTCTTGAATGTCAATTCCCAAGTAACAA
CAGTGTGTCAGGCACTTGCTAAGGATCCTAAATTGCAGCAAGGCTACAATGCTATGGGATTCTCCCAGGG
AGGCCAATTTCTGAGGGCAGTGGCTCAGAGATGCCCTTCACCTCCCATGATCAATCTGATCTCGGTTGGG
GGACAACATCAAGGTGTTTTTGGACTCCCTCGATGCCCAGGAGAGAGCTCTCACATCTGTGACTTCATCC
GAAAAACACTGAATGCTGGGGCGTACTCCAAAGTTGTTCAGGAACGCCTCGTGCAAGCCGAATACTGGCA
TGACCCCATAAAGGAGGATGTGTATCGCAACCACAGCATCTTCTTGGCAGATATAAATCAGGAGCGGGGT
ATCAATGAGTCCTACAAGAAAAACCTGATGGCCCTGAAGAAGTTTGTGATGGTGAAATTCCTCAATGATT
CCATTGTGGACCCTGTAGATTCGGAGTGGTTTGGATTTTACAGAAGTGGCCAAGCCAAGGAAACCATTCC
CTTACAGGAGACCTCCCTGTACACACAGGACCGCCTGGGGCTAAAGGAAATGGACAATGCAGGACAGCTA
GTGTTTCTGGCTACAGAAGGGGACCATCTTCAGTTGTCTGAAGAATGGTTTTATGCCCACATCATACCAT
TCCTTGGA


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC203278 protein sequence
Red=Cloning site Green=Tags(s)

MASPGCLWLLAVALLPWTCASRALQHLDPPAPLPLVIWHGMGDSCCNPLSMGAIKKMVEKKIPGIYVLSL
EIGKTLMEDVENSFFLNVNSQVTTVCQALAKDPKLQQGYNAMGFSQGGQFLRAVAQRCPSPPMINLISVG
GQHQGVFGLPRCPGESSHICDFIRKTLNAGAYSKVVQERLVQAEYWHDPIKEDVYRNHSIFLADINQERG
INESYKKNLMALKKFVMVKFLNDSIVDPVDSEWFGFYRSGQAKETIPLQETSLYTQDRLGLKEMDNAGQL
VFLATEGDHLQLSEEWFYAHIIPFLG

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_000310
ORF Size 918 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_000310.4
RefSeq Size 2504 bp
RefSeq ORF 921 bp
Locus ID 5538
UniProt ID P50897
Cytogenetics 1p34.2
Domains Palm_thioest
Protein Families Druggable Genome
Protein Pathways Fatty acid elongation in mitochondria, Lysosome, Metabolic pathways
MW 34.2 kDa
Summary The protein encoded by this gene is a small glycoprotein involved in the catabolism of lipid-modified proteins during lysosomal degradation. The encoded enzyme removes thioester-linked fatty acyl groups such as palmitate from cysteine residues. Defects in this gene are a cause of infantile neuronal ceroid lipofuscinosis 1 (CLN1, or INCL) and neuronal ceroid lipofuscinosis 4 (CLN4). Two transcript variants encoding different isoforms have been found for this gene.[provided by RefSeq, Dec 2008]
Write Your Own Review
You're reviewing:PPT1 (NM_000310) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC203278L1 Lenti ORF clone of Human palmitoyl-protein thioesterase 1 (PPT1), transcript variant 1, Myc-DDK-tagged 10 ug
$600.00
RC203278L2 Lenti ORF clone of Human palmitoyl-protein thioesterase 1 (PPT1), transcript variant 1, mGFP tagged 10 ug
$600.00
RC203278L3 Lenti ORF clone of Human palmitoyl-protein thioesterase 1 (PPT1), transcript variant 1, Myc-DDK-tagged 10 ug
$600.00
RC203278L4 Lenti ORF clone of Human palmitoyl-protein thioesterase 1 (PPT1), transcript variant 1, mGFP tagged 10 ug
$600.00
RG203278 PPT1 (tGFP-tagged) - Human palmitoyl-protein thioesterase 1 (PPT1), transcript variant 1 10 ug
$489.00 MSRP $500.00 MSRP $500.00
SC119961 PPT1 (untagged)-Human palmitoyl-protein thioesterase 1 (PPT1), transcript variant 1 10 ug
$300.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.