G gamma12 (GNG12) (NM_018841) Human Tagged ORF Clone

SKU
RC203268
GNG12 (Myc-DDK-tagged)-Human guanine nucleotide binding protein (G protein), gamma 12 (GNG12)
  • TrueORF Gold

    Protein expression verified by Western blot, fully sequenced and in stock

    Click here to learn more.

$150.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol G gamma12
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC203268 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGTCCAGCAAAACAGCAAGCACCAACAATATAGCCCAGGCAAGGAGAACTGTGCAGCAGTTAAGATTAG
AAGCCTCCATTGAAGGAATAAAGGTTTCGAAGGCATCAGCGGACCTCATGTCCTACTGTGAGGAACATGC
CAGGAGTGACCCTTTGCTGATAGGAATACCAACTTCAGAAAACCCTTTCAAGGATAAAAAAACTTGCATC
ATCTTA


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC203268 protein sequence
Red=Cloning site Green=Tags(s)

MSSKTASTNNIAQARRTVQQLRLEASIEGIKVSKASADLMSYCEEHARSDPLLIGIPTSENPFKDKKTCI
IL

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_018841
ORF Size 216 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_018841.2
RefSeq Size 4427 bp
RefSeq ORF 219 bp
Locus ID 55970
UniProt ID Q9UBI6
Cytogenetics 1p31.3
Domains G-gamma
Protein Families Druggable Genome
Protein Pathways Chemokine signaling pathway, MAPK signaling pathway, Regulation of actin cytoskeleton
MW 7.9 kDa
Summary Guanine nucleotide-binding proteins (G proteins) are involved as a modulator or transducer in various transmembrane signaling systems. The beta and gamma chains are required for the GTPase activity, for replacement of GDP by GTP, and for G protein-effector interaction.[UniProtKB/Swiss-Prot Function]
Write Your Own Review
You're reviewing:G gamma12 (GNG12) (NM_018841) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC203268L1 Lenti ORF clone of Human guanine nucleotide binding protein (G protein), gamma 12 (GNG12), Myc-DDK-tagged 10 ug
$450.00
RC203268L2 Lenti ORF clone of Human guanine nucleotide binding protein (G protein), gamma 12 (GNG12), mGFP tagged 10 ug
$450.00
RC203268L3 Lenti ORF clone of Human guanine nucleotide binding protein (G protein), gamma 12 (GNG12), Myc-DDK-tagged 10 ug
$450.00
RC203268L4 Lenti ORF clone of Human guanine nucleotide binding protein (G protein), gamma 12 (GNG12), mGFP tagged 10 ug
$450.00
RG203268 GNG12 (tGFP-tagged) - Human guanine nucleotide binding protein (G protein), gamma 12 (GNG12) 10 ug
$489.00
SC113379 GNG12 (untagged)-Human guanine nucleotide binding protein (G protein), gamma 12 (GNG12) 10 ug
$150.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.