trfp (MED20) (NM_004275) Human Tagged ORF Clone

SKU
RC203152
MED20 (Myc-DDK-tagged)-Human mediator complex subunit 20 (MED20)
  • TrueORF Gold

    Protein expression verified by Western blot, fully sequenced and in stock

    Click here to learn more.

$300.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol trfp
Synonyms PRO0213; SRB2; TRFP
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC203152 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGGAGTGACTTGTGTGTCCCAGATGCCTGTGGCCGAGGGCAAGAGTGTTCAGCAAACCGTAGAGCTCC
TTACCCGGAAATTGGAGATGCTTGGGGCAGAGAAGCAAGGAACATTTTGTGTGGACTGTGAGACTTACCA
TACGGCCGCCTCTACCCTTGGCAGCCAAGGTCAGACCGGGAAGCTGATGTATGTGATGCACAACTCAGAG
TACCCATTGAGCTGTTTCGCCCTCTTTGAGAATGGCCCTTGCCTTATTGCTGACACCAACTTTGATGTGC
TTATGGTGAAGCTCAAGGGCTTTTTCCAGAGTGCTAAGGCCAGCAAGATTGAGACCCGGGGCACCAGGTA
CCAGTACTGTGACTTCCTGGTGAAGGTGGGCACGGTCACAATGGGGCCCAGTGCCCGGGGCATCTCTGTG
GAGGTGGAGTATGGCCCCTGTGTGGTAGCTAGTGACTGCTGGAGTCTGCTGCTCGAGTTCCTACAGAGTT
TTCTAGGCAGCCACACACCAGGGGCTCCCGCAGTGTTTGGGAACAGACATGATGCGGTCTACGGCCCAGC
AGATACCATGGTCCAGTACATGGAACTCTTCAACAAGATCCGCAAGCAGCAGCAGGTGCCGGTGGCTGGG
ATTCGT


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC203152 protein sequence
Red=Cloning site Green=Tags(s)

MGVTCVSQMPVAEGKSVQQTVELLTRKLEMLGAEKQGTFCVDCETYHTAASTLGSQGQTGKLMYVMHNSE
YPLSCFALFENGPCLIADTNFDVLMVKLKGFFQSAKASKIETRGTRYQYCDFLVKVGTVTMGPSARGISV
EVEYGPCVVASDCWSLLLEFLQSFLGSHTPGAPAVFGNRHDAVYGPADTMVQYMELFNKIRKQQQVPVAG
IR

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_004275
ORF Size 636 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_004275.5
RefSeq Size 2478 bp
RefSeq ORF 639 bp
Locus ID 9477
UniProt ID Q9H944
Cytogenetics 6p21.1
MW 23.2 kDa
Summary This gene encodes a component of the mediator complex (also known as TRAP, SMCC, DRIP, or ARC), a transcriptional coactivator complex thought to be required for the expression of almost all genes. The mediator complex is recruited by transcriptional activators or nuclear receptors to induce gene expression, by interacting with RNA polymerase II and promoting the formation of a transcriptional pre-initiation complex. A mutation in this gene has been associated with a novel infantile-onset neurodegenerative movement disorder. Alternatively spliced transcript variants have been identified. [provided by RefSeq, Mar 2015]
Write Your Own Review
You're reviewing:trfp (MED20) (NM_004275) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC203152L1 Lenti ORF clone of Human mediator complex subunit 20 (MED20), Myc-DDK-tagged 10 ug
$600.00
RC203152L2 Lenti ORF clone of Human mediator complex subunit 20 (MED20), mGFP tagged 10 ug
$600.00
RC203152L3 Lenti ORF clone of Human mediator complex subunit 20 (MED20), Myc-DDK-tagged 10 ug
$600.00
RC203152L4 Lenti ORF clone of Human mediator complex subunit 20 (MED20), mGFP tagged 10 ug
$600.00
RG203152 MED20 (tGFP-tagged) - Human mediator complex subunit 20 (MED20) 10 ug
$500.00
SC319829 MED20 (untagged)-Human mediator complex subunit 20 (MED20) 10 ug
$300.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.