CSN3 (NM_005212) Human Tagged ORF Clone

SKU
RC203116
CSN3 (Myc-DDK-tagged)-Human casein kappa (CSN3)
  • TrueORF®
    TrueORF®

    Expression-ready ORF plasmid with C-terminal tag(s)

    Click here to learn more.

$289.00 MSRP $300.00 MSRP $300.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol CSN3
Synonyms CNS10; CSN10; CSNK; KCA
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC203116 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGAAAAGTTTTCTTCTAGTTGTCAATGCCCTGGCATTAACCCTGCCTTTTTTGGCTGTGGAGGTTCAAA
ACCAGAAACAACCAGCATGCCATGAGAATGATGAAAGACCATTCTATCAGAAAACAGCTCCATATGTCCC
AATGTATTATGTGCCAAATAGCTATCCTTATTATGGAACCAATTTGTACCAACGTAGACCAGCTATAGCA
ATTAATAATCCATGTGTGCCTCGCACATATTATGCAAACCCAGCTGTAGTTAGGCCACATGCCCAAATTC
CTCAGCGGCAATACCTGCCAAATAGCCACCCACCCACTGTGGTACGTCGCCCAAACCTGCATCCATCATT
TATTGCCATCCCCCCAAAGAAAATTCAGGATAAAATAATCATCCCTACCATCAATACCATTGCTACTGTT
GAACCTACACCAGCTCCTGCCACTGAACCAACGGTGGACAGTGTAGTCACTCCAGAAGCTTTTTCAGAGT
CCATCATCACGAGCACCCCTGAGACAACCACAGTTGCAGTTACTCCACCTACGGCA


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC203116 protein sequence
Red=Cloning site Green=Tags(s)

MKSFLLVVNALALTLPFLAVEVQNQKQPACHENDERPFYQKTAPYVPMYYVPNSYPYYGTNLYQRRPAIA
INNPCVPRTYYANPAVVRPHAQIPQRQYLPNSHPPTVVRRPNLHPSFIAIPPKKIQDKIIIPTINTIATV
EPTPAPATEPTVDSVVTPEAFSESIITSTPETTTVAVTPPTA

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_005212
ORF Size 546 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_005212.2
RefSeq Size 834 bp
RefSeq ORF 549 bp
Locus ID 1448
UniProt ID P07498
Cytogenetics 4q13.3
Protein Families Secreted Protein
MW 20.2 kDa
Summary Kappa-casein stabilizes micelle formation, preventing casein precipitation in milk.[UniProtKB/Swiss-Prot Function]
Write Your Own Review
You're reviewing:CSN3 (NM_005212) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC203116L1 Lenti ORF clone of Human casein kappa (CSN3), Myc-DDK-tagged 10 ug
$600.00
RC203116L2 Lenti ORF clone of Human casein kappa (CSN3), mGFP tagged 10 ug
$600.00
RC203116L3 Lenti ORF clone of Human casein kappa (CSN3), Myc-DDK-tagged 10 ug
$600.00
RC203116L4 Lenti ORF clone of Human casein kappa (CSN3), mGFP tagged 10 ug
$600.00
RG203116 CSN3 (tGFP-tagged) - Human casein kappa (CSN3) 10 ug
$489.00 MSRP $500.00 MSRP $500.00
SC126241 CSN3 (untagged)-Human casein kappa (CSN3) 10 ug
$300.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.