TSPAN31 (NM_005981) Human Tagged ORF Clone

SKU
RC203105
TSPAN31 (Myc-DDK-tagged)-Human tetraspanin 31 (TSPAN31)
  • TrueORF Gold

    Protein expression verified by Western blot, fully sequenced and in stock

    Click here to learn more.

$300.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol TSPAN31
Synonyms SAS
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC203105 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGTTTGTGGCGGCTTTGCCTGCTCCAAGAATGCGCTTTGCGCTCTCAACGTGGTCTACATGCTGGTGA
GCTTGTTGCTCATTGGAGTGGCTGCTTGGGGCAAGGGCCTGGGTCTGGTGTCCAGCATCCACATCATCGG
CGGAGTCATTGCTGTGGGAGTCTTCCTTCTCCTTATTGCAGTGGCTGGACTGGTGGGTGCTGTCAACCAC
CACCAAGTCCTGCTGTTCTTTTACATGATCATCCTTGGTTTGGTCTTCATCTTCCAATTTGTAATCTCTT
GCTCATGTCTGGCTATTAACCGAAGCAAACAGACAGATGTCATCAATGCTTCTTGGTGGGTCATGAGCAA
CAAGACTCGGGATGAACTGGAAAGAAGTTTTGATTGTTGTGGCTTATTCAACCTCACAACCCTGTATCAA
CAAGATTATGATTTCTGCACTGCAATCTGCAAGAGCCAGAGCCCCACATGCCAGATGTGTGGAGAAAAGT
TTCTTAAGCATTCAGACGAAGCCCTGAAAATCCTAGGGGGTGTTGGACTCTTCTTTAGCTTTACAGAGAT
CCTTGGTGTTTGGCTAGCAATGAGATTTCGGAATCAGAAGGATCCTAGAGCCAACCCCAGTGCCTTTCTA


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC203105 protein sequence
Red=Cloning site Green=Tags(s)

MVCGGFACSKNALCALNVVYMLVSLLLIGVAAWGKGLGLVSSIHIIGGVIAVGVFLLLIAVAGLVGAVNH
HQVLLFFYMIILGLVFIFQFVISCSCLAINRSKQTDVINASWWVMSNKTRDELERSFDCCGLFNLTTLYQ
QDYDFCTAICKSQSPTCQMCGEKFLKHSDEALKILGGVGLFFSFTEILGVWLAMRFRNQKDPRANPSAFL

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_005981
ORF Size 630 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_005981.5
RefSeq Size 1749 bp
RefSeq ORF 633 bp
Locus ID 6302
UniProt ID Q12999
Cytogenetics 12q14.1
Domains transmembrane4
Protein Families Druggable Genome, Transmembrane
MW 23.1 kDa
Summary The protein encoded by this gene is a member of the transmembrane 4 superfamily, also known as the tetraspanin family. Most of these members are cell-surface proteins that are characterized by the presence of four hydrophobic domains. The proteins mediate signal transduction events that play a role in the regulation of cell development, activation, growth and motility. This encoded protein is thought to be involved in growth-related cellular processes. This gene is associated with tumorigenesis and osteosarcoma. [provided by RefSeq, Jul 2008]
Write Your Own Review
You're reviewing:TSPAN31 (NM_005981) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC203105L3 Lenti ORF clone of Human tetraspanin 31 (TSPAN31), Myc-DDK-tagged 10 ug
$600.00
RC203105L4 Lenti ORF clone of Human tetraspanin 31 (TSPAN31), mGFP tagged 10 ug
$600.00
RG203105 TSPAN31 (tGFP-tagged) - Human tetraspanin 31 (TSPAN31) 10 ug
$489.00 MSRP $500.00 MSRP $500.00
SC319241 TSPAN31 (untagged)-Human tetraspanin 31 (TSPAN31) 10 ug
$300.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.