SUV39H2 (NM_024670) Human Tagged ORF Clone

SKU
RC203032
SUV39H2 (Myc-DDK-tagged)-Human suppressor of variegation 3-9 homolog 2 (Drosophila) (SUV39H2), transcript variant 3
  • TrueORF Gold

    Protein expression verified by Western blot, fully sequenced and in stock

    Click here to learn more.

$457.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol SUV39H2
Synonyms KMT1B
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC203032 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGAATATTATCTTGTAAAATGGAAAGGATGGCCAGATTCTACAAATACTTGGGAACCTTTGCAAAATC
TGAAGTGCCCGTTACTGCTTCAGCAATTCTCTAATGACAAGCATAATTATTTATCTCAGGTAAAGAAAGG
CAAAGCAATAACTCCAAAAGACAATAACAAAACTTTGAAACCTGCCATTGCTGAGTACATTGTGAAGAAG
GCTAAACAAAGGATAGCTCTGCAGAGATGGCAAGATGAACTCAACAGAAGAAAGAATCATAAAGGAATGA
TATTTGTTGAAAATACTGTTGATTTAGAGGGCCCACCTTCAGACTTCTATTACATTAACGAATACAAACC
AGCTCCTGGAATCAGCTTAGTCAATGAAGCTACCTTTGGTTGTTCATGCACAGATTGCTTCTTTCAAAAA
TGTTGTCCTGCTGAAGCTGGAGTTCTTTTGGCTTATAATAAAAACCAACAAATTAAAATCCCACCTGGTA
CTCCCATCTATGAATGCAACTCAAGGTGTCAGTGTGGTCCTGATTGTCCCAATAGGATTGTACAAAAAGG
CACACAGTATTCGCTTTGCATCTTTCGAACTAGCAATGGACGTGGCTGGGGTGTAAAGACCCTTGTGAAG
ATTAAAAGAATGAGTTTTGTCATGGAATATGTTGGAGAGGTAATCACAAGTGAAGAAGCTGAAAGACGAG
GACAGTTCTATGACAACAAGGGAATCACGTATCTCTTTGATCTGGACTATGAGTCTGATGAATTCACAGT
GGATGCGGCTCGATACGGCAATGTGTCTCATTTTGTGAATCACAGCTGTGACCCAAATCTTCAGGTGTTC
AATGTTTTCATTGATAACCTCGATACTCGTCTTCCCCGAATAGCATTGTTTTCCACAAGAACCATAAATG
CTGGAGAAGAGCTGACTTTTGATTATCAAATGAAAGGTTCTGGAGATATATCTTCAGATTCTATTGACCA
CAGCCCAGCCAAAAAGAGGGTCAGAACAGTATGTAAATGTGGAGCTGTGACTTGCAGAGGTTACCTCAAC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC203032 protein sequence
Red=Cloning site Green=Tags(s)

MEYYLVKWKGWPDSTNTWEPLQNLKCPLLLQQFSNDKHNYLSQVKKGKAITPKDNNKTLKPAIAEYIVKK
AKQRIALQRWQDELNRRKNHKGMIFVENTVDLEGPPSDFYYINEYKPAPGISLVNEATFGCSCTDCFFQK
CCPAEAGVLLAYNKNQQIKIPPGTPIYECNSRCQCGPDCPNRIVQKGTQYSLCIFRTSNGRGWGVKTLVK
IKRMSFVMEYVGEVITSEEAERRGQFYDNKGITYLFDLDYESDEFTVDAARYGNVSHFVNHSCDPNLQVF
NVFIDNLDTRLPRIALFSTRTINAGEELTFDYQMKGSGDISSDSIDHSPAKKRVRTVCKCGAVTCRGYLN

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_024670
ORF Size 1050 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_024670.3, NP_078946.1
RefSeq Size 3093 bp
RefSeq ORF 1053 bp
Locus ID 79723
UniProt ID Q9H5I1
Cytogenetics 10p13
Protein Families Druggable Genome
Protein Pathways Lysine degradation
MW 39.9 kDa
Summary Histone methyltransferase that specifically trimethylates 'Lys-9' of histone H3 using monomethylated H3 'Lys-9' as substrate. H3 'Lys-9' trimethylation represents a specific tag for epigenetic transcriptional repression by recruiting HP1 (CBX1, CBX3 and/or CBX5) proteins to methylated histones. Mainly functions in heterochromatin regions, thereby playing a central role in the establishment of constitutive heterochromatin at pericentric and telomere regions. H3 'Lys-9' trimethylation is also required to direct DNA methylation at pericentric repeats. SUV39H1 is targeted to histone H3 via its interaction with RB1 and is involved in many processes, such as cell cycle regulation, transcriptional repression and regulation of telomere length. May participate in regulation of higher-order chromatin organization during spermatogenesis. Recruited by the large PER complex to the E-box elements of the circadian target genes such as PER2 itself or PER1, contributes to the conversion of local chromatin to a heterochromatin-like repressive state through H3 'Lys-9' trimethylation.[UniProtKB/Swiss-Prot Function]
Write Your Own Review
You're reviewing:SUV39H2 (NM_024670) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC203032L1 Lenti ORF clone of Human suppressor of variegation 3-9 homolog 2 (Drosophila) (SUV39H2), transcript variant 3, Myc-DDK-tagged 10 ug
$757.00
RC203032L2 Lenti ORF clone of Human suppressor of variegation 3-9 homolog 2 (Drosophila) (SUV39H2), transcript variant 3, mGFP tagged 10 ug
$757.00
RC203032L3 Lenti ORF clone of Human suppressor of variegation 3-9 homolog 2 (Drosophila) (SUV39H2), transcript variant 3, Myc-DDK-tagged 10 ug
$757.00
RC203032L4 Lenti ORF clone of Human suppressor of variegation 3-9 homolog 2 (Drosophila) (SUV39H2), transcript variant 3, mGFP tagged 10 ug
$757.00
RG203032 SUV39H2 (tGFP-tagged) - Human suppressor of variegation 3-9 homolog 2 (Drosophila) (SUV39H2), transcript variant 3 10 ug
$489.00 MSRP $657.00 MSRP $657.00
SC125719 SUV39H2 (untagged)-Human suppressor of variegation 3-9 homolog 2 (Drosophila) (SUV39H2), transcript variant 3 10 ug
$457.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.