ZNF397 (NM_032347) Human Tagged ORF Clone

SKU
RC203025
ZNF397 (Myc-DDK-tagged)-Human zinc finger protein 397 (ZNF397), transcript variant 2
  • TrueORF Gold

    Protein expression verified by Western blot, fully sequenced and in stock

    Click here to learn more.

$300.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol ZNF397
Synonyms ZNF47; ZSCAN15
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC203025 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCTGTGGAATCTGGAGTGATTTCAACCCTGATACCTCAGGATCCTCCGGAACAAGAACTAATACTAG
TGAAAGTAGAAGATAACTTTTCCTGGGATGAGAAATTTAAGCAGAATGGGAGTACTCAATCCTGCCAAGA
ATTGTTTCGTCAGCAATTCAGAAAATTTTGCTACCAGGAGACACCTGGGCCCCGGGAGGCTCTGAGCCGA
CTCCAGGAACTTTGCTATCAGTGGCTAATGCCAGAGTTGCACACAAAGGAGCAGATCTTAGAACTGCTGG
TACTGGAGCAGTTCCTGAGCATTCTGCCTGAGGAGCTGCAGATCTGGGTTCAGCAACATAATCCAGAAAG
CGGCGAGGAAGCTGTGACCCTGTTGGAGGATTTAGAGAGGGAGTTTGATGACCCAGGGCAGCAGGTCCCA
GCTAGTCCACAGGGACCAGCAGTGCCATGGAAGGATTTAACATGTCTCAGAGCATCCCAAGAGTCAACAG
ACATCCACCTCCAGCCCTTAAAGACACAGCTGAAATCCTGGAAACCATGCCTTTCCCCTAAAAGTGATTG
TGAGAACAGTGAAACAGCAACAAAAGAGGGCATCTCAGAAGAAAAATCACAGGGACTCCCTCAGGAACCT
TCATTTCGAGGAATTAAGTTGTCCAGACCTCCCAAAGCTTCTTCAGCTATCCGTTGGGAATGTGTTTCTC
CAGGAAGTTTTCCCGGCGATATCATAGCTGCTGAGGCTACACATTCAACAATTTCTTGCTTTGCCATCAA
CACTTTGCCAGCCACCATCCTGCCATCTAAAAATGTGAATAGAAAGTATTTTTCC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC203025 protein sequence
Red=Cloning site Green=Tags(s)

MAVESGVISTLIPQDPPEQELILVKVEDNFSWDEKFKQNGSTQSCQELFRQQFRKFCYQETPGPREALSR
LQELCYQWLMPELHTKEQILELLVLEQFLSILPEELQIWVQQHNPESGEEAVTLLEDLEREFDDPGQQVP
ASPQGPAVPWKDLTCLRASQESTDIHLQPLKTQLKSWKPCLSPKSDCENSETATKEGISEEKSQGLPQEP
SFRGIKLSRPPKASSAIRWECVSPGSFPGDIIAAEATHSTISCFAINTLPATILPSKNVNRKYFS

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_032347
ORF Size 825 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_032347.3
RefSeq Size 1494 bp
RefSeq ORF 828 bp
Locus ID 84307
UniProt ID Q8NF99
Cytogenetics 18q12.2
Domains LER
Protein Families Transcription Factors
MW 31.1 kDa
Summary This gene encodes a protein with a N-terminal SCAN domain, and the longer isoform contains nine C2H2-type zinc finger repeats in the C-terminal domain. The protein localizes to centromeres during interphase and early prophase, and different isoforms can repress or activate transcription in transfection studies. Multiple transcript variants encoding different isoforms have been found for this gene. Additional variants have been described, but their biological validity has not been determined. [provided by RefSeq, Oct 2009]
Write Your Own Review
You're reviewing:ZNF397 (NM_032347) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC203025L3 Lenti ORF clone of Human zinc finger protein 397 (ZNF397), transcript variant 2, Myc-DDK-tagged 10 ug
$600.00
RC203025L4 Lenti ORF clone of Human zinc finger protein 397 (ZNF397), transcript variant 2, mGFP tagged 10 ug
$600.00
RG203025 ZNF397 (tGFP-tagged) - Human zinc finger protein 397 (ZNF397), transcript variant 2 10 ug
$489.00 MSRP $500.00 MSRP $500.00
SC319130 ZNF397 (untagged)-Human zinc finger protein 397 (ZNF397), transcript variant 2 10 ug
$300.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.