Protein atonal homolog 8 (ATOH8) (NM_032827) Human Tagged ORF Clone

SKU
RC203005
ATOH8 (Myc-DDK-tagged)-Human atonal homolog 8 (Drosophila) (ATOH8)
  • TrueORF Gold

    Protein expression verified by Western blot, fully sequenced and in stock

    Click here to learn more.

$450.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol Protein atonal homolog 8
Synonyms bHLHa21; HATH6
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC203005 representing NM_032827
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGAAGCACATCCCGGTCCTCGAGGACGGGCCGTGGAAGACCGTGTGCGTGAAGGAGCTGAACGGCCTTA
AGAAGCTCAAGCGGAAAGGCAAGGAGCCGGCGCGGCGCGCGAACGGCTATAAAACTTTCCGACTGGACTT
GGAAGCGCCCGAGCCCCGCGCCGTAGCCACCAACGGGCTGCGGGACAGGACCCATCGGCTGCAGCCGGTC
CCGGTACCGGTGCCGGTGCCAGTCCCAGTGGCGCCGGCCGTTCCCCCAAGAGGGGGCACGGACACAGCCG
GGGAGCGCGGGGGCTCTCGGGCGCCCGAGGTCTCCGACGCGCGGAAACGCTGCTTCGCCCTAGGCGCAGT
GGGGCCAGGACTCCCCACGCCGCCGCCGCCGCCGCCTCCTGCGCCCCAGAGCCAGGCACCTGGGGGCCCA
GAGGCACAGCCTTTCCGGGAGCCGGGTCCGCGTCCTCGCATCTTGCTGTGCGCACCGCCCGCGCGCCCCG
CGCCGTCAGCACCCCCAGCACCGCCAGCGCCCCCGGAGTCCACTGTGCGCCCTGCGCCCCCGACGCGCCC
CGGGGAAAGTTCCTACTCGTCAATTTCACACGTAATTTACAATAACCACCAGGATTCCTCCGCGTCGCCT
AGGAAACGACCGGGCGAAGCGACTGCCGCCTCCTCCGAGATCAAAGCCCTGCAGCAGACCCGGAGGCTCC
TGGCGAACGCCAGGGAGCGGACGCGGGTGCACACCATCAGCGCAGCCTTCGAGGCGCTCAGGAAGCAGGT
GCCGTGCTACTCATATGGGCAGAAGCTGTCCAAACTGGCCATCCTGAGGATCGCCTGTAACTACATCCTG
TCCCTGGCGCGGCTGGCTGACCTTGACTACAGTGCCGACCACAGCAACCTCAGCTTCTCCGAGTGTGTGC
AGCGCTGCACCCGCACCCTGCAGGCCGAGGGACGTGCCAAGAAGCGCAAGGAG


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC203005 representing NM_032827
Red=Cloning site Green=Tags(s)

MKHIPVLEDGPWKTVCVKELNGLKKLKRKGKEPARRANGYKTFRLDLEAPEPRAVATNGLRDRTHRLQPV
PVPVPVPVPVAPAVPPRGGTDTAGERGGSRAPEVSDARKRCFALGAVGPGLPTPPPPPPPAPQSQAPGGP
EAQPFREPGPRPRILLCAPPARPAPSAPPAPPAPPESTVRPAPPTRPGESSYSSISHVIYNNHQDSSASP
RKRPGEATAASSEIKALQQTRRLLANARERTRVHTISAAFEALRKQVPCYSYGQKLSKLAILRIACNYIL
SLARLADLDYSADHSNLSFSECVQRCTRTLQAEGRAKKRKE

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_032827
ORF Size 963 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_032827.5
RefSeq Size 2455 bp
RefSeq ORF 966 bp
Locus ID 84913
UniProt ID Q96SQ7
Cytogenetics 2p11.2
MW 34.5 kDa
Summary Transcription factor that binds a palindromic (canonical) core consensus DNA sequence 5'-CANNTG- 3' known as an E-box element, possibly as a heterodimer with other bHLH proteins (PubMed:24236640). Regulates endothelial cell proliferation, migration and tube-like structures formation (PubMed:24463812). Modulates endothelial cell differentiation through NOS3 (PubMed:24463812). May be implicated in specification and differentiation of neuronal cell lineages in the brain (By similarity). May participate in kidney development and may be involved in podocyte differentiation (By similarity). During early embryonic development is involved in tissue-specific differentiation processes that are dependent on class II bHLH factors and namely modulates the differentiation program initiated by the pro-endocrine factor NEUROG3 (By similarity). During myogenesis, may play a role during the transition of myoblasts from the proliferative phase to the differentiation phase (By similarity). Positively regulates HAMP transcription in two ways, firstly by acting directly on the HAMP promoter via E-boxes binding and indirectly through increased phosphorylation of SMAD protein complex (PubMed:24236640). Repress NEUROG3-dependent gene activation in a gene-specific manner through at least two mechanisms; requires only either the sequestering of a general partner such as TCF3 through heterodimerization, either also requires binding of the bHLH domain to DNA via a basic motif (By similarity).[UniProtKB/Swiss-Prot Function]
Write Your Own Review
You're reviewing:Protein atonal homolog 8 (ATOH8) (NM_032827) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC203005L1 Lenti ORF clone of Human atonal homolog 8 (Drosophila) (ATOH8), Myc-DDK-tagged 10 ug
$750.00
RC203005L2 Lenti ORF clone of Human atonal homolog 8 (Drosophila) (ATOH8), mGFP tagged 10 ug
$750.00
RC203005L3 Lenti ORF clone of Human atonal homolog 8 (Drosophila) (ATOH8), Myc-DDK-tagged 10 ug
$750.00
RC203005L4 Lenti ORF clone of Human atonal homolog 8 (Drosophila) (ATOH8), mGFP tagged 10 ug
$750.00
RG203005 ATOH8 (tGFP-tagged) - Human atonal homolog 8 (Drosophila) (ATOH8) 10 ug
$489.00 MSRP $650.00 MSRP $650.00
SC305507 ATOH8 (untagged)-Human atonal homolog 8 (Drosophila) (ATOH8) 10 ug
$450.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.