DUSP2 (NM_004418) Human Tagged ORF Clone

SKU
RC202878
DUSP2 (Myc-DDK-tagged)-Human dual specificity phosphatase 2 (DUSP2)
  • TrueORF Gold

    Protein expression verified by Western blot, fully sequenced and in stock

    Click here to learn more.

$450.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol DUSP2
Synonyms PAC-1; PAC1
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC202878 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGGGCTGGAGGCGGCGCGCGAGCTGGAGTGCGCGGCGCTGGGCACGCTGCTGCGGGATCCGCGGGAGG
CGGAACGCACGCTGCTGCTGGACTGCCGCCCCTTCCTGGCCTTCTGCCGGCGCCACGTGCGCGCCGCGCG
GCCAGTGCCTTGGAACGCGCTGCTGCGGCGCCGCGCGCGCGGCCCTCCTGCCGCCGTTCTCGCCTGCCTG
CTGCCCGACCGCGCGCTGCGGACGCGCCTGGTCCGCGGGGAGCTGGCGCGGGCCGTGGTGCTGGACGAGG
GCAGTGCCTCGGTGGCGGAGCTCCGGCCCGACAGCCCGGCTCATGTGCTGCTGGCCGCGCTGCTGCACGA
GACCCGCGCGGGGCCCACTGCCGTGTACTTCCTGCGAGGAGGCTTCGACGGCTTCCAGGGCTGCTGTCCC
GATCTGTGCTCTGAGGCCCCCGCCCCTGCGCTGCCGCCAACAGGGGACAAAACCAGCCGCTCCGACTCCA
GGGCTCCTGTCTACGACCAGGGTGGCCCTGTGGAGATCTTGCCCTACCTGTTCCTGGGCAGCTGCAGTCA
CTCGTCAGACCTGCAGGGGCTGCAGGCCTGTGGCATCACAGCCGTCCTCAACGTGTCCGCCAGCTGCCCC
AACCACTTTGAGGGCCTTTTCCGCTACAAGAGTATCCCTGTGGAGGACAACCAGATGGTGGAGATCAGTG
CCTGGTTCCAGGAGGCCATAGGCTTCATTGACTGGGTGAAGAACAGCGGAGGCCGGGTGCTGGTGCACTG
CCAGGCGGGTATCTCGCGCTCTGCCACCATCTGTCTGGCATACCTCATGCAGAGTCGCCGTGTGCGGCTG
GACGAGGCCTTTGACTTCGTTAAGCAGCGCCGGGGGGTCATCTCCCCCAACTTCAGTTTCATGGGGCAGC
TGCTGCAGTTTGAGACCCAGGTGCTGTGTCAC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC202878 protein sequence
Red=Cloning site Green=Tags(s)

MGLEAARELECAALGTLLRDPREAERTLLLDCRPFLAFCRRHVRAARPVPWNALLRRRARGPPAAVLACL
LPDRALRTRLVRGELARAVVLDEGSASVAELRPDSPAHVLLAALLHETRAGPTAVYFLRGGFDGFQGCCP
DLCSEAPAPALPPTGDKTSRSDSRAPVYDQGGPVEILPYLFLGSCSHSSDLQGLQACGITAVLNVSASCP
NHFEGLFRYKSIPVEDNQMVEISAWFQEAIGFIDWVKNSGGRVLVHCQAGISRSATICLAYLMQSRRVRL
DEAFDFVKQRRGVISPNFSFMGQLLQFETQVLCH

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_004418
ORF Size 942 bp
OTI Disclaimer Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery.

The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_004418.4
RefSeq Size 1708 bp
RefSeq ORF 945 bp
Locus ID 1844
UniProt ID Q05923
Cytogenetics 2q11.2
Domains DSPc, PTPc_motif, RHOD
Protein Families Druggable Genome, Phosphatase
Protein Pathways MAPK signaling pathway
MW 34.4 kDa
Summary The protein encoded by this gene is a member of the dual specificity protein phosphatase subfamily. These phosphatases inactivate their target kinases by dephosphorylating both the phosphoserine/threonine and phosphotyrosine residues. They negatively regulate members of the mitogen-activated protein (MAP) kinase superfamily (MAPK/ERK, SAPK/JNK, p38), which are associated with cellular proliferation and differentiation. Different members of the family of dual specificity phosphatases show distinct substrate specificities for various MAP kinases, different tissue distribution and subcellular localization, and different modes of inducibility of their expression by extracellular stimuli. This gene product inactivates ERK1 and ERK2, is predominantly expressed in hematopoietic tissues, and is localized in the nucleus. [provided by RefSeq, Jul 2008]
Write Your Own Review
You're reviewing:DUSP2 (NM_004418) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC202878L1 Lenti ORF clone of Human dual specificity phosphatase 2 (DUSP2), Myc-DDK-tagged 10 ug
$750.00
RC202878L2 Lenti ORF clone of Human dual specificity phosphatase 2 (DUSP2), mGFP tagged 10 ug
$750.00
RC202878L3 Lenti ORF clone of Human dual specificity phosphatase 2 (DUSP2), Myc-DDK-tagged 10 ug
$750.00
RC202878L4 Lenti ORF clone of Human dual specificity phosphatase 2 (DUSP2), mGFP tagged 10 ug
$750.00
RG202878 DUSP2 (tGFP-tagged) - Human dual specificity phosphatase 2 (DUSP2) 10 ug
$650.00
SC319175 DUSP2 (untagged)-Human dual specificity phosphatase 2 (DUSP2) 10 ug
$450.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.