LETM1 (NM_012318) Human Tagged ORF Clone

CAT#: RC202855

Reviews ()
Write a review

LETM1 (Myc-DDK-tagged)-Human leucine zipper-EF-hand containing transmembrane protein 1 (LETM1), nuclear gene encoding mitochondrial protein



  "NM_012318" in other vectors (7)

Special Offer: 20% off the control vector (empty cloning vector without insert). Use code "Shuttle20".

USD 691.00


Availability*
In Stock

Size
    • 10 ug


Product images

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol LETM1
Synonyms SLC55A1
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC202855 representing NM_012318
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCGTCCATCTTACTGAGGAGCTGCCGCGGCCGGGCGCCCGCCCGCCTCCCGCCGCCGCCTCGGTACA
CCGTCCCGCGGGGTAGTCCAGGGGATCCTGCTCATCTCAGCTGTGCCAGCACCCTGGGGTTGAGGAACTG
CCTGAATGTTCCATTTGGCTGCTGCACTCCCATCCACCCTGTGTACACATCCTCCAGAGGCGATCACCTC
GGCTGTTGGGCTCTGAGGCCCGAGTGCCTTCGCATAGTGTCGAGAGCGCCATGGACCTCTACCTCTGTGG
GTTTTGTGGCTGTGGGACCTCAGTGCCTTCCTGTGCGTGGCTGGCACTCTTCGCGCCCTGTTCGCGATGA
CTCGGTAGTAGAGAAGTCCCTCAAGTCCTTGAAGGACAAGAACAAGAAGCTGGAGGAAGGCGGCCCGGTG
TACAGCCCCCCCGCAGAGGTGGTGGTGAAGAAGTCCCTGGGGCAGCGGGTGCTGGACGAGCTGAAGCACT
ACTACCATGGCTTCCGCCTGCTATGGATCGACACCAAGATCGCGGCACGCATGCTCTGGCGCATCCTCAA
CGGCCACAGCCTGACCCGCCGGGAGCGCAGGCAGTTTCTCCGGATCTGCGCTGACCTCTTCCGCCTGGTG
CCGTTCCTTGTGTTCGTGGTGGTGCCGTTCATGGAGTTTCTGCTGCCTGTTGCTGTGAAGCTCTTCCCCA
ACATGTTGCCATCCACATTTGAGACTCAGTCACTCAAGGAGGAGAGGCTGAAGAAGGAGCTTCGGGTCAA
GCTGGAGCTGGCCAAGTTCCTCCAGGACACCATCGAGGAGATGGCCTTGAAGAACAAGGCAGCCAAGGGC
AGCGCCACCAAAGACTTCTCTGTGTTTTTCCAGAAGATCCGGGAAACAGGGGAGAGGCCCAGCAATGAGG
AAATCATGCGTTTTTCCAAATTATTTGAGGATGAGCTGACCCTGGACAACCTGACACGGCCGCAGCTGGT
GGCCCTGTGCAAGCTGCTGGAGCTACAGTCCATCGGCACCAACAACTTCCTGCGCTTCCAGCTTACCATG
CGGCTGCGCTCCATAAAGGCAGACGACAAGCTGATTGCTGAGGAAGGGGTGGACAGCCTGAATGTCAAGG
AGCTGCAGGCAGCGTGTCGGGCACGAGGCATGCGGGCCCTGGGCGTCACGGAAGACCGCCTGAGGGGTCA
GCTGAAGCAGTGGCTGGACCTGCACCTGCATCAGGAGATCCCCACATCGCTGCTCATCCTGTCCCGGGCC
ATGTACCTCCCGGACACCCTCTCTCCAGCCGACCAGCTCAAGTCCACACTGCAGACCCTCCCAGAGATTG
TGGCAAAGGAAGCACAGGTGAAAGTGGCCGAGGTGGAGGGCGAGCAGGTGGACAACAAGGCCAAGCTGGA
GGCCACGCTGCAGGAGGAGGCGGCCATCCAGCAGGAGCACCGTGAGAAGGAGCTGCAGAAGCGCTCGGAG
GTGGCGAAGGATTTTGAGCCCGAACGTGTGGTAGCTGCTCCCCAAAGGCCGGGGACCGAGCCACAGCCAG
AAATGCCTGACACAGTCCTGCAGTCAGAGACCTTGAAGGACACTGCCCCGGTGCTGGAGGGCTTGAAGGA
GGAAGAGATCACGAAGGAGGAAATCGACATCCTCAGCGATGCCTGCTCTAAGCTGCAGGAGCAGAAGAAG
TCACTCACCAAGGAGAAGGAGGAGCTGGAGCTGCTGAAGGAGGATGTGCAGGACTACAGCGAGGACTTGC
AGGAGATCAAGAAGGAACTTTCAAAGACTGGTGAAGAAAAATACGTGGAAGAATCTAAAGCCAGCAAGAG
ATTGACAAAAAGGGTGCAGCAAATGATCGGGCAGATCGATGGCTTGATCTCGCAGCTGGAGATGGACCAG
CAGGCTGGCAAGCTGGCCCCGGCCAACGGCATGCCCACGGGGGAGAACGTCATCAGTGTCGCTGAGCTCA
TCAACGCCATGAAGCAAGTCAAGCACATTCCCGAAAGCAAGCTCACCAGCCTGGCCGCAGCACTGGATGA
AAACAAGGATGGCAAGGTCAACATCGACGACCTCGTCAAGGTGATTGAGCTGGTGGACAAAGAAGATGTT
CACATCTCCACCAGCCAGGTGGCTGAGATTGTAGCAACACTGGAAAAAGAGGAGAAGGTGGAGGAGAAGG
AGAAGGCCAAAGAGAAGGCAGAGAAGGAGGTCGCAGAGGTGAAGAGC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC202855 representing NM_012318
Red=Cloning site Green=Tags(s)

MASILLRSCRGRAPARLPPPPRYTVPRGSPGDPAHLSCASTLGLRNCLNVPFGCCTPIHPVYTSSRGDHL
GCWALRPECLRIVSRAPWTSTSVGFVAVGPQCLPVRGWHSSRPVRDDSVVEKSLKSLKDKNKKLEEGGPV
YSPPAEVVVKKSLGQRVLDELKHYYHGFRLLWIDTKIAARMLWRILNGHSLTRRERRQFLRICADLFRLV
PFLVFVVVPFMEFLLPVAVKLFPNMLPSTFETQSLKEERLKKELRVKLELAKFLQDTIEEMALKNKAAKG
SATKDFSVFFQKIRETGERPSNEEIMRFSKLFEDELTLDNLTRPQLVALCKLLELQSIGTNNFLRFQLTM
RLRSIKADDKLIAEEGVDSLNVKELQAACRARGMRALGVTEDRLRGQLKQWLDLHLHQEIPTSLLILSRA
MYLPDTLSPADQLKSTLQTLPEIVAKEAQVKVAEVEGEQVDNKAKLEATLQEEAAIQQEHREKELQKRSE
VAKDFEPERVVAAPQRPGTEPQPEMPDTVLQSETLKDTAPVLEGLKEEEITKEEIDILSDACSKLQEQKK
SLTKEKEELELLKEDVQDYSEDLQEIKKELSKTGEEKYVEESKASKRLTKRVQQMIGQIDGLISQLEMDQ
QAGKLAPANGMPTGENVISVAELINAMKQVKHIPESKLTSLAAALDENKDGKVNIDDLVKVIELVDKEDV
HISTSQVAEIVATLEKEEKVEEKEKAKEKAEKEVAEVKS

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_012318
ORF Size 2217 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_012318.1, NP_036450.1
RefSeq Size 3907 bp
RefSeq ORF 2220 bp
Locus ID 3954
UniProt ID O95202
Cytogenetics 4p16.3
Protein Families Transmembrane
MW 83.35 kDa
Gene Summary This gene encodes a protein that is localized to the inner mitochondrial membrane. The protein functions to maintain the mitochondrial tubular shapes and is required for normal mitochondrial morphology and cellular viability. Mutations in this gene cause Wolf-Hirschhorn syndrome, a complex malformation syndrome caused by the deletion of parts of the distal short arm of chromosome 4. Related pseudogenes have been identified on chromosomes 8, 15 and 19. [provided by RefSeq, Oct 2009]

Other Versions

Other products for "LETM1"
Frequently bought together (5)
Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 30 ul

USD 165.00


pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 627.00


Rabbit Polyclonal antibody to LETM1 (leucine zipper-EF-hand containing transmembrane protein 1)
    • 100 ul

USD 473.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

USD 149.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

USD 55.00

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.