CIAO2B (NM_016062) Human Tagged ORF Clone

SKU
RC202825
FAM96B (Myc-DDK-tagged)-Human family with sequence similarity 96, member B (FAM96B), transcript variant 1
  • TrueORF Gold

    Protein expression verified by Western blot, fully sequenced and in stock

    Click here to learn more.

$150.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol CIAO2B
Synonyms CGI-128; CIA2B; FAM96B; MIP18
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC202825 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGTAGGCGGCGGCGGGGTCGGCGGCGGCCTCCTGGAGAATGCCAACCCCCTCATCTACCAGCGCTCTG
GGGAGCGGCCTGTGACGGCAGGCGAGGAGGACGAGCAGGTTCCCGACAGCATCGACGCACGCGAGATCTT
CGATCTGATTCGCTCCATCAATGACCCGGAGCATCCACTGACGCTAGAGGAGTTGAACGTAGTAGAGCAG
GTGCGGGTTCAGGTTAGCGACCCCGAGAGTACAGTGGCTGTGGCTTTCACACCAACCATTCCGCACTGCA
GCATGGCCACCCTTATTGGTCTGTCCATCAAGGTCAAGCTTCTGCGCTCCCTTCCTCAGCGTTTCAAGAT
GGACGTGCACATTACTCCGGGGACCCATGCCTCAGAGCATGCAGTGAACAAGCAACTTGCAGATAAGGAG
CGGGTGGCAGCTGCCCTGGAGAACACCCACCTCTTGGAGGTTGTGAATCAGTGCCTGTCAGCCCGCTCC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC202825 protein sequence
Red=Cloning site Green=Tags(s)

MVGGGGVGGGLLENANPLIYQRSGERPVTAGEEDEQVPDSIDAREIFDLIRSINDPEHPLTLEELNVVEQ
VRVQVSDPESTVAVAFTPTIPHCSMATLIGLSIKVKLLRSLPQRFKMDVHITPGTHASEHAVNKQLADKE
RVAAALENTHLLEVVNQCLSARS

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_016062
ORF Size 489 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_016062.4
RefSeq Size 716 bp
RefSeq ORF 492 bp
Locus ID 51647
UniProt ID Q9Y3D0
Cytogenetics 16q22.1
MW 17.7 kDa
Summary Component of the cytosolic iron-sulfur protein assembly (CIA) complex, a multiprotein complex that mediates the incorporation of iron-sulfur cluster into extramitochondrial Fe/S proteins (PubMed:23891004, PubMed:22678362, PubMed:22678361). As a CIA complex component and in collaboration with CIAO1 and MMS19, binds to and facilitates the assembly of most cytosolic-nuclear Fe/S proteins (PubMed:23891004). As part of the mitotic spindle-associated MMXD complex it plays a role in chromosome segregation, probably by facilitating iron-sulfur cluster assembly into ERCC2/XPD (PubMed:20797633).[UniProtKB/Swiss-Prot Function]
Write Your Own Review
You're reviewing:CIAO2B (NM_016062) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC202825L1 Lenti ORF clone of Human family with sequence similarity 96, member B (FAM96B), transcript variant 1, Myc-DDK-tagged 10 ug
$450.00
RC202825L2 Lenti ORF clone of Human family with sequence similarity 96, member B (FAM96B), transcript variant 1, mGFP tagged 10 ug
$450.00
RC202825L3 Lenti ORF clone of Human family with sequence similarity 96, member B (FAM96B), transcript variant 1, Myc-DDK-tagged 10 ug
$450.00
RC202825L4 Lenti ORF clone of Human family with sequence similarity 96, member B (FAM96B), transcript variant 1, mGFP tagged 10 ug
$450.00
RG202825 FAM96B (tGFP-tagged) - Human family with sequence similarity 96, member B (FAM96B), transcript variant 1 10 ug
$489.00
SC122835 FAM96B (untagged)-Human family with sequence similarity 96, member B (FAM96B), transcript variant 1 10 ug
$150.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.