PSMC6 (NM_002806) Human Tagged ORF Clone

SKU
RC202809
PSMC6 (Myc-DDK-tagged)-Human proteasome (prosome, macropain) 26S subunit, ATPase, 6 (PSMC6)
  • TrueORF Gold

    Protein expression verified by Western blot, fully sequenced and in stock

    Click here to learn more.

$457.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol PSMC6
Synonyms p42; RPT5; SUG2
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC202809 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCGGACCCTAGAGATAAGGCGCTTCAGGACTACCGCAAGAAGTTGCTTGAACACAAGGAGATCGACG
GCCGTCTTAAGGAGTTAAGGGAACAATTAAAAGAACTTACCAAGCAGTATGAAAAGTCTGAAAATGATCT
GAAGGCCCTACAGAGTGTTGGGCAGATCGTGGGTGAAGTGCTTAAACAGTTAACTGAAGAAAAATTCATT
GTTAAAGCTACCAATGGACCAAGATATGTTGTGGGTTGTCGTCGACAGCTTGACAAAAGTAAGCTGAAGC
CAGGAACAAGAGTTGCTTTGGATATGACTACACTAACTATCATGAGATATTTGCCGAGAGAGGTGGATCC
ACTGGTTTATAACATGTCTCATGAGGACCCTGGGAATGTTTCTTATTCTGAGATTGGAGGGCTATCAGAA
CAGATCCGGGAATTAAGAGAGGTGATAGAATTACCTCTTACAAACCCAGAGTTATTTCAGCGTGTAGGAA
TAATACCTCCAAAAGGCTGTTTGTTATATGGACCACCAGGTACGGGAAAAACACTCTTGGCACGAGCCGT
TGCTAGCCAGCTGGACTGCAATTTCTTAAAGGTTGTATCTAGTTCTATTGTAGACAAGTACATTGGTGAA
AGTGCTCGTTTGATCAGAGAAATGTTTAATTATGCTAGAGATCATCAACCATGCATCATTTTTATGGATG
AAATAGATGCTATTGGTGGTCGTCGGTTTTCTGAGGGTACTTCAGCTGACAGAGAGATTCAGAGAACGTT
AATGGAGTTACTGAATCAAATGGATGGATTTGATACTCTGCATAGAGTTAAAATGATCATGGCTACAAAC
AGACCAGATACACTGGATCCTGCTTTGCTGCGTCCAGGAAGATTAGATAGAAAAATACATATTGATTTGC
CAAATGAACAAGCAAGATTAGACATACTGAAAATCCATGCAGGTCCCATTACAAAGCATGGTGAAATAGA
TTATGAAGCAATTGTGAAGCTTTCGGATGGCTTTAATGGAGCAGATCTGAGAAATGTTTGTACTGAAGCA
GGTATGTTCGCAATTCGTGCTGATCATGATTTTGTAGTACAGGAAGACTTCATGAAAGCAGTCAGAAAAG
TGGCTGATTCTAAGAAGCTGGAGTCTAAATTGGACTACAAACCTGTG


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC202809 protein sequence
Red=Cloning site Green=Tags(s)

MADPRDKALQDYRKKLLEHKEIDGRLKELREQLKELTKQYEKSENDLKALQSVGQIVGEVLKQLTEEKFI
VKATNGPRYVVGCRRQLDKSKLKPGTRVALDMTTLTIMRYLPREVDPLVYNMSHEDPGNVSYSEIGGLSE
QIRELREVIELPLTNPELFQRVGIIPPKGCLLYGPPGTGKTLLARAVASQLDCNFLKVVSSSIVDKYIGE
SARLIREMFNYARDHQPCIIFMDEIDAIGGRRFSEGTSADREIQRTLMELLNQMDGFDTLHRVKMIMATN
RPDTLDPALLRPGRLDRKIHIDLPNEQARLDILKIHAGPITKHGEIDYEAIVKLSDGFNGADLRNVCTEA
GMFAIRADHDFVVQEDFMKAVRKVADSKKLESKLDYKPV

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_002806
ORF Size 1167 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_002806.5
RefSeq Size 1599 bp
RefSeq ORF 1170 bp
Locus ID 5706
UniProt ID P62333
Cytogenetics 14q22.1
Domains AAA
Protein Pathways Proteasome
MW 44.2 kDa
Summary The 26S proteasome is a multicatalytic proteinase complex with a highly ordered structure composed of 2 complexes, a 20S core and a 19S regulator. The 20S core is composed of 4 rings of 28 non-identical subunits; 2 rings are composed of 7 alpha subunits and 2 rings are composed of 7 beta subunits. The 19S regulator is composed of a base, which contains 6 ATPase subunits and 2 non-ATPase subunits, and a lid, which contains up to 10 non-ATPase subunits. Proteasomes are distributed throughout eukaryotic cells at a high concentration and cleave peptides in an ATP/ubiquitin-dependent process in a non-lysosomal pathway. An essential function of a modified proteasome, the immunoproteasome, is the processing of class I MHC peptides. This gene encodes one of the ATPase subunits, a member of the triple-A family of ATPases which have a chaperone-like activity. Pseudogenes have been identified on chromosomes 8 and 12. [provided by RefSeq, Jul 2008]
Write Your Own Review
You're reviewing:PSMC6 (NM_002806) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC202809L1 Lenti ORF clone of Human proteasome (prosome, macropain) 26S subunit, ATPase, 6 (PSMC6), Myc-DDK-tagged 10 ug
$757.00
RC202809L2 Lenti ORF clone of Human proteasome (prosome, macropain) 26S subunit, ATPase, 6 (PSMC6), mGFP tagged 10 ug
$757.00
RC202809L3 Lenti ORF clone of Human proteasome (prosome, macropain) 26S subunit, ATPase, 6 (PSMC6), Myc-DDK-tagged 10 ug
$757.00
RC202809L4 Lenti ORF clone of Human proteasome (prosome, macropain) 26S subunit, ATPase, 6 (PSMC6), mGFP tagged 10 ug
$757.00
RC229193 PSMC6 (Myc-DDK-tagged)-Human proteasome (prosome, macropain) 26S subunit, ATPase, 6 (PSMC6) 10 ug
$457.00
RC229193L1 Lenti ORF clone of Human proteasome (prosome, macropain) 26S subunit, ATPase, 6 (PSMC6), Myc-DDK-tagged 10 ug
$757.00
RC229193L3 Lenti ORF clone of Human proteasome (prosome, macropain) 26S subunit, ATPase, 6 (PSMC6), Myc-DDK-tagged 10 ug
$757.00
RG202809 PSMC6 (tGFP-tagged) - Human proteasome (prosome, macropain) 26S subunit, ATPase, 6 (PSMC6) 10 ug
$489.00 MSRP $657.00 MSRP $657.00
RG229193 PSMC6 (tGFP-tagged) - Human proteasome (prosome, macropain) 26S subunit, ATPase, 6 (PSMC6) 10 ug
$657.00
SC118427 PSMC6 (untagged)-Human proteasome (prosome, macropain) 26S subunit, ATPase, 6 (PSMC6) 10 ug
$457.00
SC320812 PSMC6 (untagged)-Human proteasome (prosome, macropain) 26S subunit, ATPase, 6 (PSMC6) 10 ug
$457.00
SC327828 PSMC6 (untagged)-Human proteasome (prosome macropain) 26S subunit ATPase 6 (PSMC6) 10 ug
$503.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.