Glutathione S Transferase theta 1 (GSTT1) (NM_000853) Human Tagged ORF Clone

SKU
RC202807
GSTT1 (Myc-DDK-tagged)-Human glutathione S-transferase theta 1 (GSTT1)
  • TrueORF Gold

    Protein expression verified by Western blot, fully sequenced and in stock

    Click here to learn more.

$450.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol Glutathione S Transferase theta 1
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC202807 representing NM_000853
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGGCCTGGAGCTGTACCTGGACCTGCTGTCCCAGCCCTGCCGCGCTGTTTACATCTTTGCCAAGAAGA
ACGACATTCCCTTCGAGCTGCGCATCGTGGATCTGATTAAAGGTCAGCACTTAAGCGATGCCTGTGCCCA
GGTGAACCCCCTCAAGAAGGTGCCAGCCTTGAAGGACGGGGACTTCACCTTGACGGAGAGTGTGGCCATC
CTGCTCTACCTGACGCGCAAATATAAGGTCCCTGACTACTGGTACCCTCAGGACCTGCAGGCCCGTGCCC
GTGTGGATGAGTACCTGGCATGGCAGCACACGACTCTGCGGAGAAGCTGCCTCCGGGCCTTGTGGCATAA
GGTGATGTTCCCTGTTTTCCTGGGTGAGCCAGTATCTCCCCAGACACTGGCAGCCACCCTGGCAGAGTTG
GATGTGACCCTGCAGTTGCTCGAGGACAAGTTCCTCCAGAACAAGGCCTTCCTTACTGGTCCTCACATCT
CCTTAGCTGACCTCGTAGCCATCACGGAGCTGATGCATCCCGTGGGTGCTGGCTGCCAAGTCTTCGAAGG
CCGACCCAAGCTGGCCACATGGCGGCAGCGCGTGGAGGCAGCAGTGGGGGAGGACCTCTTCCAGGAGGCC
CATGAGGTCATTCTGAAGGCCAAGGACTTCCCACCTGCAGACCCCACCATAAAACAGAAGCTGATGCCCT
GGGTGCTGGCCATGATCCGG


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC202807 representing NM_000853
Red=Cloning site Green=Tags(s)

MGLELYLDLLSQPCRAVYIFAKKNDIPFELRIVDLIKGQHLSDACAQVNPLKKVPALKDGDFTLTESVAI
LLYLTRKYKVPDYWYPQDLQARARVDEYLAWQHTTLRRSCLRALWHKVMFPVFLGEPVSPQTLAATLAEL
DVTLQLLEDKFLQNKAFLTGPHISLADLVAITELMHPVGAGCQVFEGRPKLATWRQRVEAAVGEDLFQEA
HEVILKAKDFPPADPTIKQKLMPWVLAMIR

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_000853
ORF Size 720 bp
OTI Disclaimer Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery.

The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_000853.3
RefSeq Size 1004 bp
RefSeq ORF 723 bp
Locus ID 2952
UniProt ID P30711
Cytogenetics 22q11.23
Domains GST_C, GST_N
Protein Pathways Drug metabolism - cytochrome P450, Glutathione metabolism, Metabolism of xenobiotics by cytochrome P450
MW 27.2 kDa
Summary The protein encoded by this gene, glutathione S-transferase (GST) theta 1 (GSTT1), is a member of a superfamily of proteins that catalyze the conjugation of reduced glutathione to a variety of electrophilic and hydrophobic compounds. Human GSTs can be divided into five main classes: alpha, mu, pi, theta, and zeta. The theta class includes GSTT1, GSTT2, and GSTT2B. GSTT1 and GSTT2/GSTT2B share 55% amino acid sequence identity and may play a role in human carcinogenesis. The GSTT1 gene is haplotype-specific and is absent from 38% of the population. Alternative splicing of this gene results in multiple transcript variants. [provided by RefSeq, Sep 2015]
Write Your Own Review
You're reviewing:Glutathione S Transferase theta 1 (GSTT1) (NM_000853) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC202807L3 Lenti ORF clone of Human glutathione S-transferase theta 1 (GSTT1), Myc-DDK-tagged 10 ug
$750.00
RC202807L4 Lenti ORF clone of Human glutathione S-transferase theta 1 (GSTT1), mGFP tagged 10 ug
$750.00
RG202807 GSTT1 (tGFP-tagged) - Human glutathione S-transferase theta 1 (GSTT1) 10 ug
$650.00
SC319671 GSTT1 (untagged)-Human glutathione S-transferase theta 1 (GSTT1) 10 ug
$450.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.