Centrin 3 (CETN3) (NM_004365) Human Tagged ORF Clone

SKU
RC202804
CETN3 (Myc-DDK-tagged)-Human centrin, EF-hand protein, 3 (CETN3)
  • TrueORF Gold

    Protein expression verified by Western blot, fully sequenced and in stock

    Click here to learn more.

$300.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol Centrin 3
Synonyms CDC31; CEN3
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC202804 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGAGTTTAGCTCTGAGAAGTGAGCTTGTAGTGGACAAAACAAAGAGGAAAAAAAGAAGAGAACTGTCTG
AGGAACAGAAACAAGAAATTAAAGATGCTTTTGAACTATTTGATACAGACAAAGATGAAGCAATAGATTA
TCATGAATTAAAGGTGGCAATGAGAGCCTTGGGGTTTGATGTAAAAAAAGCTGATGTACTGAAGATTCTT
AAAGATTATGACAGAGAAGCCACAGGGAAAATCACCTTTGAAGATTTTAATGAAGTTGTGACAGACTGGA
TATTGGAAAGAGATCCCCATGAAGAAATACTCAAGGCATTTAAACTATTTGATGATGATGATTCAGGTAA
AATAAGCTTGAGGAATTTGCGACGTGTTGCTAGAGAATTGGGTGAAAACATGAGTGATGAAGAACTTCGA
GCTATGATAGAAGAATTTGACAAAGATGGTGATGGAGAAATAAACCAAGAGGAGTTCATTGCTATTATGA
CTGGTGACATT


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC202804 protein sequence
Red=Cloning site Green=Tags(s)

MSLALRSELVVDKTKRKKRRELSEEQKQEIKDAFELFDTDKDEAIDYHELKVAMRALGFDVKKADVLKIL
KDYDREATGKITFEDFNEVVTDWILERDPHEEILKAFKLFDDDDSGKISLRNLRRVARELGENMSDEELR
AMIEEFDKDGDGEINQEEFIAIMTGDI

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_004365
ORF Size 501 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_004365.4
RefSeq Size 1374 bp
RefSeq ORF 504 bp
Locus ID 1070
UniProt ID O15182
Cytogenetics 5q14.3
Domains EFh
Protein Families Druggable Genome
MW 19.6 kDa
Summary The protein encoded by this gene contains four EF-hand calcium binding domains, and is a member of the centrin protein family. Centrins are evolutionarily conserved proteins similar to the CDC31 protein of S. cerevisiae. Yeast CDC31 is located at the centrosome of interphase and mitotic cells, where it plays a fundamental role in centrosome duplication and separation. Multiple forms of the proteins similar to the yeast centrin have been identified in human and other mammalian cells, some of which have been shown to be associated with centrosome fractions. This protein appears to be one of the most abundant centrins associated with centrosome, which suggests a similar function to its yeast counterpart. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2014]
Write Your Own Review
You're reviewing:Centrin 3 (CETN3) (NM_004365) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC202804L3 Lenti ORF clone of Human centrin, EF-hand protein, 3 (CETN3), Myc-DDK-tagged 10 ug
$600.00
RC202804L4 Lenti ORF clone of Human centrin, EF-hand protein, 3 (CETN3), mGFP tagged 10 ug
$600.00
RG202804 CETN3 (tGFP-tagged) - Human centrin, EF-hand protein, 3 (CETN3) 10 ug
$489.00 MSRP $500.00 MSRP $500.00
SC319201 CETN3 (untagged)-Human centrin, EF-hand protein, 3 (CETN3) 10 ug
$300.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.