LSM3 (NM_014463) Human Tagged ORF Clone

SKU
RC202793
LSM3 (Myc-DDK-tagged)-Human LSM3 homolog, U6 small nuclear RNA associated (S. cerevisiae) (LSM3)
  • TrueORF Gold

    Protein expression verified by Western blot, fully sequenced and in stock

    Click here to learn more.

$150.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol LSM3
Synonyms SMX4; USS2; YLR438C
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC202793 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCGGACGACGTAGACCAGCAACAAACTACCAACACTGTAGAGGAGCCCCTGGATCTTATCAGGCTCA
GCCTAGATGAGCGAATTTATGTGAAAATGAGAAATGACCGAGAGCTTCGAGGCAGATTACATGCTTATGA
TCAACATTTAAATATGATCTTGGGAGATGTGGAAGAAACTGTGACTACTATAGAAATTGATGAAGAAACA
TATGAAGAGATATATAAATCAACGAAACGGAATATTCCAATGCTCTTTGTCCGGGGAGATGGCGTTGTCC
TGGTTGCCCCCCCACTGAGAGTTGGC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC202793 protein sequence
Red=Cloning site Green=Tags(s)

MADDVDQQQTTNTVEEPLDLIRLSLDERIYVKMRNDRELRGRLHAYDQHLNMILGDVEETVTTIEIDEET
YEEIYKSTKRNIPMLFVRGDGVVLVAPPLRVG

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_014463
ORF Size 306 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_014463.3
RefSeq Size 695 bp
RefSeq ORF 309 bp
Locus ID 27258
UniProt ID P62310
Cytogenetics 3p25.1
Domains Sm
Protein Families Stem cell - Pluripotency
Protein Pathways RNA degradation, Spliceosome
MW 11.8 kDa
Summary Sm-like proteins were identified in a variety of organisms based on sequence homology with the Sm protein family (see SNRPD2; MIM 601061). Sm-like proteins contain the Sm sequence motif, which consists of 2 regions separated by a linker of variable length that folds as a loop. The Sm-like proteins are thought to form a stable heteromer present in tri-snRNP particles, which are important for pre-mRNA splicing.[supplied by OMIM, Apr 2004]
Write Your Own Review
You're reviewing:LSM3 (NM_014463) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC202793L3 Lenti ORF clone of Human LSM3 homolog, U6 small nuclear RNA associated (S. cerevisiae) (LSM3), Myc-DDK-tagged 10 ug
$450.00
RC202793L4 Lenti ORF clone of Human LSM3 homolog, U6 small nuclear RNA associated (S. cerevisiae) (LSM3), mGFP tagged 10 ug
$450.00
RG202793 LSM3 (tGFP-tagged) - Human LSM3 homolog, U6 small nuclear RNA associated (S. cerevisiae) (LSM3) 10 ug
$489.00
SC114972 LSM3 (untagged)-Human LSM3 homolog, U6 small nuclear RNA associated (S. cerevisiae) (LSM3) 10 ug
$150.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.