GLT28D1 (ALG13) (NM_018466) Human Tagged ORF Clone

SKU
RC202762
ALG13 (Myc-DDK-tagged)-Human asparagine-linked glycosylation 13 homolog (S. cerevisiae) (ALG13), transcript variant 2
  • TrueORF Gold

    Protein expression verified by Western blot, fully sequenced and in stock

    Click here to learn more.

$150.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol GLT28D1
Synonyms CDG1S; CXorf45; DEE36; EIEE36; GLT28D1; MDS031; TDRD13; YGL047W
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC202762 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGAAGTGCGTGTTTGTTACCGTAGGGACCACCAGCTTTGACGACCTCATTGCGTGTGTGTCGGCGCCCG
ACAGTCTGCAAAAAATCGAGAGCCTTGGTTACAACCGACTTATCCTGCAAATTGGTAGAGGAACGGTGGT
ACCTGAACCCTTCAGTACTGAGTCGTTTACTCTGGATGTTTACAGGTACAAGGATTCCTTGAAAGAAGAC
ATTCAGAAAGCAGATCTTGTTATTAGTCACGCAGGTGCAGGAAGCTGTTTGGAGACTCTGGAAAAAGGAA
AGCCACTCGTAGTGGTTATAAACGAAAAGTTGATGAACAATCATCAGCTGGAACTGGCAAAGCAGCTACA
CAAAGAGGGTCATCTCTTCTATTGTACCTGCAGCACGCTTCCTGGGCTGTTACAGTCAATGGACTTATCA
ACACTGAAATGTTATCCTCCTGGCCAGCCAGAAAAATTTTCTGCATTTTTGGATAAAGTTGTTGGATTAC
AAAAA


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC202762 protein sequence
Red=Cloning site Green=Tags(s)

MKCVFVTVGTTSFDDLIACVSAPDSLQKIESLGYNRLILQIGRGTVVPEPFSTESFTLDVYRYKDSLKED
IQKADLVISHAGAGSCLETLEKGKPLVVVINEKLMNNHQLELAKQLHKEGHLFYCTCSTLPGLLQSMDLS
TLKCYPPGQPEKFSAFLDKVVGLQK

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_018466
ORF Size 495 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_018466.6
RefSeq Size 2993 bp
RefSeq ORF 498 bp
Locus ID 79868
UniProt ID Q9NP73
Cytogenetics Xq23
Domains Glyco_tran_28_C
Protein Pathways Metabolic pathways, N-Glycan biosynthesis
MW 18.2 kDa
Summary The protein encoded by this gene is a subunit of a bipartite UDP-N-acetylglucosamine transferase. It heterodimerizes with asparagine-linked glycosylation 14 homolog to form a functional UDP-GlcNAc glycosyltransferase that catalyzes the second sugar addition of the highly conserved oligosaccharide precursor in endoplasmic reticulum N-linked glycosylation. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Dec 2009]
Write Your Own Review
You're reviewing:GLT28D1 (ALG13) (NM_018466) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC202762L3 Lenti ORF clone of Human asparagine-linked glycosylation 13 homolog (S. cerevisiae) (ALG13), transcript variant 2, Myc-DDK-tagged 10 ug
$450.00
RC202762L4 Lenti ORF clone of Human asparagine-linked glycosylation 13 homolog (S. cerevisiae) (ALG13), transcript variant 2, mGFP tagged 10 ug
$450.00
RG202762 ALG13 (tGFP-tagged) - Human asparagine-linked glycosylation 13 homolog (S. cerevisiae) (ALG13), transcript variant 2 10 ug
$489.00
SC324410 ALG13 (untagged)-Human asparagine-linked glycosylation 13 homolog (S. cerevisiae) (ALG13), transcript variant 2 10 ug
$150.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.