myosin light chain 1 (MYL1) (NM_079422) Human Tagged ORF Clone

SKU
RC202750
MYL1 (Myc-DDK-tagged)-Human myosin, light chain 1, alkali, skeletal, fast (MYL1), transcript variant 3f
  • TrueORF Gold

    Protein expression verified by Western blot, fully sequenced and in stock

    Click here to learn more.

$150.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol myosin light chain 1
Synonyms MLC1F; MLC3F; MYOFTA
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC202750 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGTCCTTCAGTGCTGACCAGATTGCTGAATTCAAGGAGGCATTTCTCCTGTTTGACAGAACAGGTGATT
CCAAGATCACCTTAAGCCAGGTCGGTGATGTCCTTCGAGCTCTGGGCACAAATCCCACCAATGCAGAGGT
CAGGAAAGTTCTGGGAAACCCCAGCAATGAAGAGCTGAATGCCAAGAAAATTGAGTTTGAACAATTTCTG
CCTATGATGCAAGCCATTTCCAACAACAAGGACCAGGCCACCTATGAAGACTTTGTTGAGGGTCTGCGTG
TCTTTGACAAGGAAGGCAATGGCACAGTCATGGGTGCTGAACTCCGCCATGTTCTAGCCACCCTGGGTGA
AAAGATGAAAGAGGAAGAAGTGGAAGCCCTGATGGCAGGTCAAGAAGACTCCAATGGCTGCATCAACTAC
GAAGCTTTTGTCAAGCACATCATGTCTATC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC202750 protein sequence
Red=Cloning site Green=Tags(s)

MSFSADQIAEFKEAFLLFDRTGDSKITLSQVGDVLRALGTNPTNAEVRKVLGNPSNEELNAKKIEFEQFL
PMMQAISNNKDQATYEDFVEGLRVFDKEGNGTVMGAELRHVLATLGEKMKEEEVEALMAGQEDSNGCINY
EAFVKHIMSI

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_079422
ORF Size 450 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_079422.3
RefSeq Size 862 bp
RefSeq ORF 453 bp
Locus ID 4632
UniProt ID P05976
Cytogenetics 2q34
Domains EFh
MW 16.7 kDa
Summary Myosin is a hexameric ATPase cellular motor protein. It is composed of two heavy chains, two nonphosphorylatable alkali light chains, and two phosphorylatable regulatory light chains. This gene encodes a myosin alkali light chain expressed in fast skeletal muscle. Two transcript variants have been identified for this gene. [provided by RefSeq, Jul 2008]
Write Your Own Review
You're reviewing:myosin light chain 1 (MYL1) (NM_079422) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC202750L3 Lenti ORF clone of Human myosin, light chain 1, alkali; skeletal, fast (MYL1), transcript variant 3f, Myc-DDK-tagged 10 ug
$450.00
RC202750L4 Lenti ORF clone of Human myosin, light chain 1, alkali; skeletal, fast (MYL1), transcript variant 3f, mGFP tagged 10 ug
$450.00
RG202750 MYL1 (tGFP-tagged) - Human myosin, light chain 1, alkali; skeletal, fast (MYL1), transcript variant 3f 10 ug
$489.00
SC120265 MYL1 (untagged)-Human myosin, light chain 1, alkali, skeletal, fast (MYL1), transcript variant 3f 10 ug
$150.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.