HUS1 (NM_004507) Human Tagged ORF Clone

SKU
RC202727
HUS1 (Myc-DDK-tagged)-Human HUS1 checkpoint homolog (S. pombe) (HUS1), transcript variant 1
  • TrueORF Gold

    Protein expression verified by Western blot, fully sequenced and in stock

    Click here to learn more.

$300.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol HUS1
Synonyms hHUS1
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC202727 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGAAGTTTCGGGCCAAGATCGTGGACGGGGCCTGTCTGAACCACTTCACACGAATCAGTAACATGATAG
CCAAGCTTGCCAAAACCTGCACCCTCCGCATCAGCCCTGATAAGCTTAACTTCATCCTTTGTGACAAGCT
GGCTAATGGAGGAGTGAGCATGTGGTGTGAGCTGGAACAGGAGAACTTCTTCAACGAATTTCAAATGGAG
GGTGTCTCTGCAGAAAACAATGAGATTTATTTAGAGCTAACATCGGAAAACTTATCTCGAGCCTTGAAGA
CTGCCCAGAATGCCAGGGCTTTGAAAATCAAACTGACTAATAAACACTTTCCCTGCCTCACGGTCTCCGT
GGAGCTGTTATCTATGTCAAGCAGTAGCCGCATTGTGACCCATGACATCCCCATAAAGGTGATTCCTAGG
AAATTGTGGAAGGACTTACAAGAACCGGTGGTCCCAGATCCTGATGTTAGTATTTATTTACCAGTCTTGA
AGACTATGAAGAGTGTTGTGGAAAAAATGAAAAACATCAGCAATCACCTTGTTATTGAAGCAAACCTAGA
TGGAGAATTGAATTTGAAAATAGAAACTGAATTAGTATGTGTTACAACTCATTTTAAAGATCTTGGAAAT
CCTCCATTAGCCTCTGAAAGCACCCATGAGGACAGAAACGTGGAACACATGGCTGAAGTGCACATAGATA
TTAGGAAGCTCCTACAGTTTCTTGCTGGACAACAAGTAAATCCCACAAAGGCCTTATGCAATATTGTGAA
TAACAAGATGGTGCATTTTGATCTGCTTCATGAAGACGTGTCCCTTCAGTATTTCATCCCTGCGCTGTCC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC202727 protein sequence
Red=Cloning site Green=Tags(s)

MKFRAKIVDGACLNHFTRISNMIAKLAKTCTLRISPDKLNFILCDKLANGGVSMWCELEQENFFNEFQME
GVSAENNEIYLELTSENLSRALKTAQNARALKIKLTNKHFPCLTVSVELLSMSSSSRIVTHDIPIKVIPR
KLWKDLQEPVVPDPDVSIYLPVLKTMKSVVEKMKNISNHLVIEANLDGELNLKIETELVCVTTHFKDLGN
PPLASESTHEDRNVEHMAEVHIDIRKLLQFLAGQQVNPTKALCNIVNNKMVHFDLLHEDVSLQYFIPALS

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_004507
ORF Size 840 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_004507.4
RefSeq Size 3033 bp
RefSeq ORF 843 bp
Locus ID 3364
UniProt ID O60921
Cytogenetics 7p12.3
Domains Hus1
Protein Families Druggable Genome
MW 31.7 kDa
Summary The protein encoded by this gene is a component of an evolutionarily conserved, genotoxin-activated checkpoint complex that is involved in the cell cycle arrest in response to DNA damage. This protein forms a heterotrimeric complex with checkpoint proteins RAD9 and RAD1. In response to DNA damage, the trimeric complex interacts with another protein complex consisting of checkpoint protein RAD17 and four small subunits of the replication factor C (RFC), which loads the combined complex onto the chromatin. The DNA damage induced chromatin binding has been shown to depend on the activation of the checkpoint kinase ATM, and is thought to be an early checkpoint signaling event. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Feb 2011]
Write Your Own Review
You're reviewing:HUS1 (NM_004507) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC202727L1 Lenti ORF clone of Human HUS1 checkpoint homolog (S. pombe) (HUS1), transcript variant 1, Myc-DDK-tagged 10 ug
$600.00
RC202727L2 Lenti ORF clone of Human HUS1 checkpoint homolog (S. pombe) (HUS1), transcript variant 1, mGFP tagged 10 ug
$600.00
RC202727L3 Lenti ORF clone of Human HUS1 checkpoint homolog (S. pombe) (HUS1), transcript variant 1, Myc-DDK-tagged 10 ug
$600.00
RC202727L4 Lenti ORF clone of Human HUS1 checkpoint homolog (S. pombe) (HUS1), transcript variant 1, mGFP tagged 10 ug
$600.00
RG202727 HUS1 (tGFP-tagged) - Human HUS1 checkpoint homolog (S. pombe) (HUS1), transcript variant 1 10 ug
$489.00 MSRP $500.00 MSRP $500.00
SC319724 HUS1 (untagged)-Human HUS1 checkpoint homolog (S. pombe) (HUS1), transcript variant 1 10 ug
$300.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.