COX7A2L (NM_004718) Human Tagged ORF Clone

SKU
RC202697
COX7A2L (Myc-DDK-tagged)-Human cytochrome c oxidase subunit VIIa polypeptide 2 like (COX7A2L), nuclear gene encoding mitochondrial protein
  • TrueORF Gold

    Protein expression verified by Western blot, fully sequenced and in stock

    Click here to learn more.

$150.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol COX7A2L
Synonyms COX7AR; COX7RP; EB1; SCAF1; SCAFI; SIG81
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC202697 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGTACTACAAGTTTAGTGGCTTCACGCAGAAGTTGGCAGGAGCATGGGCTTCGGAGGCCTATAGCCCGC
AGGGATTAAAGCCTGTGGTTTCCACAGAAGCACCACCTATCATATTTGCCACACCAACTAAACTGACCTC
CGATTCCACAGTGTATGATTATGCTGGGAAAAACAAAGTTCCAGAGCTACAAAAGTTTTTCCAGAAAGCT
GATGGTGTGCCCGTCTACCTGAAACGAGGCCTGCCTGACCAAATGCTTTACCGGACCACCATGGCGCTGA
CTGTGGGAGGGACCATCTACTGCCTGATCGCCCTCTACATGGCTTCGCAGCCCAAAAACAAA


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC202697 protein sequence
Red=Cloning site Green=Tags(s)

MYYKFSGFTQKLAGAWASEAYSPQGLKPVVSTEAPPIIFATPTKLTSDSTVYDYAGKNKVPELQKFFQKA
DGVPVYLKRGLPDQMLYRTTMALTVGGTIYCLIALYMASQPKNK

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_004718
ORF Size 342 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_004718.4
RefSeq Size 1145 bp
RefSeq ORF 345 bp
Locus ID 9167
UniProt ID O14548
Cytogenetics 2p21
Domains COX7a
Protein Families Druggable Genome, Transmembrane
Protein Pathways Alzheimer's disease, Cardiac muscle contraction, Huntington's disease, Oxidative phosphorylation, Parkinson's disease
MW 12.6 kDa
Summary Cytochrome c oxidase (COX), the terminal component of the mitochondrial respiratory chain, catalyzes the electron transfer from reduced cytochrome c to oxygen. This component is a heteromeric complex consisting of 3 catalytic subunits encoded by mitochondrial genes and multiple structural subunits encoded by nuclear genes. The mitochondrially-encoded subunits function in electron transfer, and the nuclear-encoded subunits may function in the regulation and assembly of the complex. This nuclear gene encodes a protein similar to polypeptides 1 and 2 of subunit VIIa in the C-terminal region, and also highly similar to the mouse Sig81 protein sequence. This gene is expressed in all tissues, and upregulated in a breast cancer cell line after estrogen treatment. It is possible that this gene represents a regulatory subunit of COX and mediates the higher level of energy production in target cells by estrogen. Several transcript variants, some protein-coding and others non-protein coding, have been found for this gene. [provided by RefSeq, Jan 2016]
Write Your Own Review
You're reviewing:COX7A2L (NM_004718) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC202697L3 Lenti ORF clone of Human cytochrome c oxidase subunit VIIa polypeptide 2 like (COX7A2L), nuclear gene encoding mitochondrial protein, Myc-DDK-tagged 10 ug
$450.00
RC202697L4 Lenti ORF clone of Human cytochrome c oxidase subunit VIIa polypeptide 2 like (COX7A2L), nuclear gene encoding mitochondrial protein, mGFP tagged 10 ug
$450.00
RG202697 COX7A2L (tGFP-tagged) - Human cytochrome c oxidase subunit VIIa polypeptide 2 like (COX7A2L), nuclear gene encoding mitochondrial protein 10 ug
$489.00
SC117225 COX7A2L (untagged)-Human cytochrome c oxidase subunit VIIa polypeptide 2 like (COX7A2L), nuclear gene encoding mitochondrial protein 10 ug
$150.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.