Apc10 (ANAPC10) (NM_014885) Human Tagged ORF Clone

SKU
RC202679
ANAPC10 (Myc-DDK-tagged)-Human anaphase promoting complex subunit 10 (ANAPC10)
  • TrueORF Gold

    Protein expression verified by Western blot, fully sequenced and in stock

    Click here to learn more.

$300.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol Apc10
Synonyms APC10; DOC1
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC202679 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGACTACACCAAACAAGACACCTCCTGGTGCTGACCCCAAGCAGTTGGAAAGGACTGGAACAGTACGGG
AAATTGGGTCACAAGCTGTTTGGTCACTCTCATCTTGCAAACCAGGATTTGGAGTGGATCAGTTACGAGA
TGACAATCTAGAAACTTATTGGCAATCAGATGGTTCCCAGCCTCATTTAGTGAACATCCAATTCAGAAGA
AAAACAACAGTGAAGACATTATGTATTTATGCAGACTACAAATCTGATGAAAGCTATACTCCAAGCAAGA
TCTCAGTCAGAGTAGGAAATAATTTTCACAACCTTCAAGAAATTCGGCAACTTGAGTTGGTGGAACCAAG
TGGCTGGATTCATGTTCCCTTAACTGACAATCATAAGAAGCCAACTCGTACATTCATGATACAGATTGCT
GTTCTAGCCAATCACCAGAATGGAAGAGACACCCATATGAGACAAATTAAAATATACACACCAGTAGAAG
AGAGCTCCATTGGTAAATTTCCTAGATGTACAACTATAGATTTCATGATGTATCGTTCAATAAGG


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC202679 protein sequence
Red=Cloning site Green=Tags(s)

MTTPNKTPPGADPKQLERTGTVREIGSQAVWSLSSCKPGFGVDQLRDDNLETYWQSDGSQPHLVNIQFRR
KTTVKTLCIYADYKSDESYTPSKISVRVGNNFHNLQEIRQLELVEPSGWIHVPLTDNHKKPTRTFMIQIA
VLANHQNGRDTHMRQIKIYTPVEESSIGKFPRCTTIDFMMYRSIR

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_014885
ORF Size 555 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_014885.4
RefSeq Size 1457 bp
RefSeq ORF 558 bp
Locus ID 10393
UniProt ID Q9UM13
Cytogenetics 4q31.21
Protein Families Druggable Genome
Protein Pathways Cell cycle, Oocyte meiosis, Progesterone-mediated oocyte maturation, Ubiquitin mediated proteolysis
MW 21.3 kDa
Summary ANAPC10 is a core subunit of the anaphase-promoting complex (APC), or cyclosome, a ubiquitin protein ligase that is essential for progression through the cell cycle. APC initiates sister chromatid separation by ubiquitinating the anaphase inhibitor securin (PTTG1; MIM 604147) and triggers exit from mitosis by ubiquitinating cyclin B (CCNB1; MIM 123836), the activating subunit of cyclin-dependent kinase-1 (CDK1; MIM 116940) (summary by Wendt et al., 2001 [PubMed 11524682]).[supplied by OMIM, Feb 2011]
Write Your Own Review
You're reviewing:Apc10 (ANAPC10) (NM_014885) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC202679L1 Lenti ORF clone of Human anaphase promoting complex subunit 10 (ANAPC10), Myc-DDK-tagged 10 ug
$600.00
RC202679L2 Lenti ORF clone of Human anaphase promoting complex subunit 10 (ANAPC10), mGFP tagged 10 ug
$600.00
RC202679L3 Lenti ORF clone of Human anaphase promoting complex subunit 10 (ANAPC10), Myc-DDK-tagged 10 ug
$600.00
RC202679L4 Lenti ORF clone of Human anaphase promoting complex subunit 10 (ANAPC10), mGFP tagged 10 ug
$600.00
RG202679 ANAPC10 (tGFP-tagged) - Human anaphase promoting complex subunit 10 (ANAPC10) 10 ug
$489.00 MSRP $500.00 MSRP $500.00
SC126079 ANAPC10 (untagged)-Human anaphase promoting complex subunit 10 (ANAPC10) 10 ug
$300.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.