SDOS (NUDT16L1) (NM_032349) Human Tagged ORF Clone

SKU
RC202638
NUDT16L1 (Myc-DDK-tagged)-Human nudix (nucleoside diphosphate linked moiety X)-type motif 16-like 1 (NUDT16L1), transcript variant 1
  • TrueORF Gold

    Protein expression verified by Western blot, fully sequenced and in stock

    Click here to learn more.

$300.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol SDOS
Synonyms SDOS; TIRR
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC202638 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGTCGACGGCGGCGGTTCCGGAGCTGAAGCAGATCAGCCGGGTGGAGGCGATGCGCCTAGGGCCGGGCT
GGAGCCACTCGTGCCACGCCATGCTGTACGCCGCCAACCCTGGGCAGCTCTTCGGCCGCATCCCCATGCG
CTTCTCGGTGCTGATGCAGATGCGTTTCGACGGGCTGCTGGGCTTCCCCGGGGGCTTCGTGGACCGGCGC
TTCTGGTCGCTGGAGGACGGCCTGAACCGGGTGCTGGGCCTGGGCCTGGGCTGCCTGCGCCTCACCGAGG
CCGACTACCTGAGCTCGCACCTGACCGAGGGCCCACACCGCGTCGTGGCGCACCTGTACGCGCGGCAGCT
GACGCTGGAGCAGCTGCACGCCGTGGAGATCAGCGCGGTGCACTCGCGCGACCACGGCCTGGAGGTGCTG
GGCCTCGTGCGGGTCCCGCTGTACACCCAGAAGGACCGAGTCGGAGGCTTCCCCAACTTCCTGAGCAACG
CCTTCGTGAGCACGGCTAAGTGCCAGCTCCTCTTTGCCCTCAAGGTGCTCAACATGATGCCCGAGGAGAA
GCTGGTTGAGGCCCTGGCTGCAGCCACCGAGAAGCAGAAGAAGGCCCTGGAGAAGTTGCTCCCGGCCTCC
TCT


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC202638 protein sequence
Red=Cloning site Green=Tags(s)

MSTAAVPELKQISRVEAMRLGPGWSHSCHAMLYAANPGQLFGRIPMRFSVLMQMRFDGLLGFPGGFVDRR
FWSLEDGLNRVLGLGLGCLRLTEADYLSSHLTEGPHRVVAHLYARQLTLEQLHAVEISAVHSRDHGLEVL
GLVRVPLYTQKDRVGGFPNFLSNAFVSTAKCQLLFALKVLNMMPEEKLVEALAAATEKQKKALEKLLPAS
S

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_032349
ORF Size 633 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_032349.3
RefSeq Size 1367 bp
RefSeq ORF 636 bp
Locus ID 84309
UniProt ID Q9BRJ7
Cytogenetics 16p13.3
MW 23.3 kDa
Summary Key regulator of TP53BP1 required to stabilize TP53BP1 and regulate its recruitment to chromatin (PubMed:28241136). In absence of DNA damage, interacts with the tandem Tudor-like domain of TP53BP1, masking the region that binds histone H4 dimethylated at 'Lys-20' (H4K20me2), thereby preventing TP53BP1 recruitment to chromatin and maintaining TP53BP1 localization to the nucleus (PubMed:28241136). Following DNA damage, ATM-induced phosphorylation of TP53BP1 and subsequent recruitment of RIF1 leads to dissociate NUDT16L1/TIRR from TP53BP1, unmasking the tandem Tudor-like domain and allowing recruitment of TP53BP1 to DNA double strand breaks (DSBs) (PubMed:28241136). Binds U8 snoRNA (PubMed:18820299).[UniProtKB/Swiss-Prot Function]
Write Your Own Review
You're reviewing:SDOS (NUDT16L1) (NM_032349) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC202638L3 Lenti ORF clone of Human nudix (nucleoside diphosphate linked moiety X)-type motif 16-like 1 (NUDT16L1), transcript variant 1, Myc-DDK-tagged 10 ug
$600.00
RC202638L4 Lenti ORF clone of Human nudix (nucleoside diphosphate linked moiety X)-type motif 16-like 1 (NUDT16L1), transcript variant 1, mGFP tagged 10 ug
$600.00
RG202638 NUDT16L1 (tGFP-tagged) - Human nudix (nucleoside diphosphate linked moiety X)-type motif 16-like 1 (NUDT16L1), transcript variant 1 10 ug
$489.00 MSRP $500.00 MSRP $500.00
SC320132 NUDT16L1 (untagged)-Human nudix (nucleoside diphosphate linked moiety X)-type motif 16-like 1 (NUDT16L1), transcript variant 1 10 ug
$300.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.