MCM2 (NM_004526) Human Tagged ORF Clone

CAT#: RC202506

Reviews ()
Write a review

MCM2 (Myc-DDK-tagged)-Human minichromosome maintenance complex component 2 (MCM2)



  "NM_004526" in other vectors (6)

Reconstitution Protocol

USD 828.00


Availability*
In Stock

Size
    • 10 ug


Product images

Other products for "MCM2"

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol MCM2
Synonyms BM28; CCNL1; cdc19; CDCL1; D3S3194; DFNA70; MITOTIN
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC202506 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCGGAATCATCGGAATCCTTCACCATGGCATCCAGCCCGGCCCAGCGTCGGCGAGGCAATGATCCTC
TCACCTCCAGCCCTGGCCGAAGCTCCCGGCGTACTGATGCCCTCACCTCCAGCCCTGGCCGTGACCTTCC
ACCATTTGAGGATGAGTCCGAGGGGCTCCTAGGCACAGAGGGGCCCCTGGAGGAAGAAGAGGATGGAGAG
GAGCTCATTGGAGATGGCATGGAAAGGGACTACCGCGCCATCCCAGAGCTGGACGCCTATGAGGCCGAGG
GACTGGCTCTGGATGATGAGGACGTAGAGGAGCTGACGGCCAGTCAGAGGGAGGCAGCAGAGCGGGCCAT
GCGGCAGCGTGACCGGGAGGCTGGCCGGGGCCTGGGCCGCATGCGCCGTGGGCTCCTGTATGACAGCGAT
GAGGAGGACGAGGAGCGCCCTGCCCGCAAGCGCCGCCAGGTGGAGCGGGCCACGGAGGACGGCGAGGAGG
ACGAGGAGATGATTGAGAGCATCGAGAACCTGGAGGATCTCAAAGGCCACTCTGTGCGCGAGTGGGTGAG
CATGGCGGGCCCCCGGCTGGAGATCCACCACCGCTTCAAGAACTTCCTGCGCACTCACGTCGACAGCCAC
GGCCACAACGTCTTCAAGGAGCGCATCAGCGACATGTGCAAAGAGAACCGTGAGAGCCTGGTGGTGAACT
ATGAGGACTTGGCAGCCAGGGAGCACGTGCTGGCCTACTTCCTGCCTGAGGCACCGGCGGAGCTGCTGCA
GATCTTTGATGAGGCTGCCCTGGAGGTGGTACTGGCCATGTACCCCAAGTACGACCGCATCACCAACCAC
ATCCATGTCCGCATCTCCCACCTGCCTCTGGTGGAGGAGCTGCGCTCGCTGAGGCAGCTGCATCTGAACC
AGCTGATCCGCACCAGTGGGGTGGTGACCAGCTGCACTGGCGTCCTGCCCCAGCTCAGCATGGTCAAGTA
CAACTGCAACAAGTGCAATTTCGTCCTGGGTCCTTTCTGCCAGTCCCAGAACCAGGAGGTGAAACCAGGC
TCCTGTCCTGAGTGCCAGTCGGCCGGCCCCTTTGAGGTCAACATGGAGGAGACCATCTATCAGAACTACC
AGCGTATCCGAATCCAGGAGAGTCCAGGCAAAGTGGCGGCTGGCCGGCTGCCCCGCTCCAAGGACGCCAT
TCTCCTCGCAGATCTGGTGGACAGCTGCAAGCCAGGAGACGAGATAGAGCTGACTGGCATCTATCACAAC
AACTATGATGGCTCCCTCAACACTGCCAATGGCTTCCCTGTCTTTGCCACTGTCATCCTAGCCAACCACG
TGGCCAAGAAGGACAACAAGGTTGCTGTAGGGGAACTGACCGATGAAGATGTGAAGATGATCACTAGCCT
CTCCAAGGATCAGCAGATCGGAGAGAAGATCTTTGCCAGCATTGCTCCTTCCATCTATGGTCATGAAGAC
ATCAAGAGAGGCCTGGCTCTGGCCCTGTTCGGAGGGGAGCCCAAAAACCCAGGTGGCAAGCACAAGGTAC
GTGGTGATATCAACGTGCTCTTGTGCGGAGACCCTGGCACAGCGAAGTCGCAGTTTCTCAAGTATATTGA
GAAAGTGTCCAGCCGAGCCATCTTCACCACTGGCCAGGGGGCGTCGGCTGTGGGCCTCACGGCGTATGTC
CAGCGGCACCCTGTCAGCAGGGAGTGGACCTTGGAGGCTGGGGCCCTGGTTCTGGCTGACCGAGGAGTGT
GTCTCATTGATGAATTTGACAAGATGAATGACCAGGACAGAACCAGCATCCATGAGGCCATGGAGCAACA
GAGCATCTCCATCTCGAAGGCTGGCATCGTCACCTCCCTGCAGGCTCGCTGCACGGTCATTGCTGCCGCC
AACCCCATAGGAGGGCGCTACGACCCCTCGCTGACTTTCTCTGAGAACGTGGACCTCACAGAGCCCATCA
TCTCACGCTTTGACATCCTGTGTGTGGTGAGGGACACCGTGGACCCAGTCCAGGACGAGATGCTGGCCCG
CTTCGTGGTGGGCAGCCACGTCAGACACCACCCCAGCAACAAGGAGGAGGAGGGGCTGGCCAATGGCAGC
GCTGCTGAGCCCGCCATGCCCAACACGTATGGCGTGGAGCCCCTGCCCCAGGAGGTCCTGAAGAAGTACA
TCATCTACGCCAAGGAGAGGGTCCACCCGAAGCTCAACCAGATGGACCAGGACAAGGTGGCCAAGATGTA
CAGTGACCTGAGGAAAGAATCTATGGCGACAGGCAGCATCCCCATTACGGTGCGGCACATCGAGTCCATG
ATCCGCATGGCGGAGGCCCACGCGCGCATCCATCTGCGGGACTATGTGATCGAAGACGACGTCAACATGG
CCATCCGCGTGATGCTGGAGAGCTTCATAGACACACAGAAGTTCAGCGTCATGCGCAGCATGCGCAAGAC
TTTTGCCCGCTACCTTTCATTCCGGCGTGACAACAATGAGCTGTTGCTCTTCATACTGAAGCAGTTAGTG
GCAGAGCAGGTGACATATCAGCGCAACCGCTTTGGGGCCCAGCAGGACACTATTGAGGTCCCTGAGAAGG
ACTTGGTGGATAAGGCTCGTCAGATCAACATCCACAACCTCTCTGCATTTTATGACAGTGAGCTCTTCAG
GATGAACAAGTTCAGCCACGACCTGAAAAGGAAAATGATCCTGCAGCAGTTC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC202506 protein sequence
Red=Cloning site Green=Tags(s)

MAESSESFTMASSPAQRRRGNDPLTSSPGRSSRRTDALTSSPGRDLPPFEDESEGLLGTEGPLEEEEDGE
ELIGDGMERDYRAIPELDAYEAEGLALDDEDVEELTASQREAAERAMRQRDREAGRGLGRMRRGLLYDSD
EEDEERPARKRRQVERATEDGEEDEEMIESIENLEDLKGHSVREWVSMAGPRLEIHHRFKNFLRTHVDSH
GHNVFKERISDMCKENRESLVVNYEDLAAREHVLAYFLPEAPAELLQIFDEAALEVVLAMYPKYDRITNH
IHVRISHLPLVEELRSLRQLHLNQLIRTSGVVTSCTGVLPQLSMVKYNCNKCNFVLGPFCQSQNQEVKPG
SCPECQSAGPFEVNMEETIYQNYQRIRIQESPGKVAAGRLPRSKDAILLADLVDSCKPGDEIELTGIYHN
NYDGSLNTANGFPVFATVILANHVAKKDNKVAVGELTDEDVKMITSLSKDQQIGEKIFASIAPSIYGHED
IKRGLALALFGGEPKNPGGKHKVRGDINVLLCGDPGTAKSQFLKYIEKVSSRAIFTTGQGASAVGLTAYV
QRHPVSREWTLEAGALVLADRGVCLIDEFDKMNDQDRTSIHEAMEQQSISISKAGIVTSLQARCTVIAAA
NPIGGRYDPSLTFSENVDLTEPIISRFDILCVVRDTVDPVQDEMLARFVVGSHVRHHPSNKEEEGLANGS
AAEPAMPNTYGVEPLPQEVLKKYIIYAKERVHPKLNQMDQDKVAKMYSDLRKESMATGSIPITVRHIESM
IRMAEAHARIHLRDYVIEDDVNMAIRVMLESFIDTQKFSVMRSMRKTFARYLSFRRDNNELLLFILKQLV
AEQVTYQRNRFGAQQDTIEVPEKDLVDKARQINIHNLSAFYDSELFRMNKFSHDLKRKMILQQF

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_004526
ORF Size 2712 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_004526.4
RefSeq Size 3504 bp
RefSeq ORF 2715 bp
Locus ID 4171
UniProt ID P49736
Cytogenetics 3q21.3
Domains MCM
Protein Families Druggable Genome, Stem cell - Pluripotency, Transcription Factors
Protein Pathways Cell cycle, DNA replication
MW 101.9 kDa
Gene Summary The protein encoded by this gene is one of the highly conserved mini-chromosome maintenance proteins (MCM) that are involved in the initiation of eukaryotic genome replication. The hexameric protein complex formed by MCM proteins is a key component of the pre-replication complex (pre_RC) and may be involved in the formation of replication forks and in the recruitment of other DNA replication related proteins. This protein forms a complex with MCM4, 6, and 7, and has been shown to regulate the helicase activity of the complex. This protein is phosphorylated, and thus regulated by, protein kinases CDC2 and CDC7. Multiple alternatively spliced transcript variants have been found, but the full-length nature of some variants has not been defined. [provided by RefSeq, Oct 2012]

Other Versions

Frequently bought together (4)
Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 30 ul

USD 177.00


pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 650.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

USD 160.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

USD 59.00

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.