Mel18 (PCGF2) (NM_007144) Human Tagged ORF Clone

SKU
RC202490
PCGF2 (Myc-DDK-tagged)-Human polycomb group ring finger 2 (PCGF2)
  • TrueORF Gold

    Protein expression verified by Western blot, fully sequenced and in stock

    Click here to learn more.

$457.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol Mel18
Synonyms MEL-18; RNF110; TPFS; ZNF144
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC202490 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGCATCGGACTACACGGATCAAAATCACAGAGCTGAACCCCCACCTCATGTGTGCCCTCTGCGGGGGGT
ACTTCATCGACGCCACCACTATCGTGGAGTGCCTGCATTCCTTCTGCAAAACCTGCATCGTGCGCTACCT
GGAGACCAACAAATACTGCCCCATGTGTGACGTGCAGGTCCATAAAACCCGGCCGCTGCTGAGCATCAGG
TCTGACAAAACACTTCAAGACATTGTCTACAAATTGGTCCCTGGGCTTTTTAAAGATGAGATGAAACGGC
GGCGGGATTTCTATGCAGCGTACCCCCTGACGGAGGTCCCCAACGGCTCCAATGAGGACCGCGGCGAGGT
CTTGGAGCAGGAGAAGGGGGCTCTGAGTGATGATGAGATTGTCAGCCTCTCCATCGAATTCTACGAAGGT
GCCAGGGACCGGGACGAGAAGAAGGGCCCCCTGGAGAATGGGGATGGGGACAAAGAGAAAACAGGGGTGC
GCTTCCTGCGATGCCCAGCAGCCATGACCGTCATGCATCTTGCCAAGTTTCTCCGCAACAAGATGGATGT
GCCCAGCAAGTACAAGGTGGAGGTTCTGTACGAGGACGAGCCACTGAAGGAATACTACACCCTCATGGAC
ATCGCCTACATCTACCCCTGGCGGCGGAACGGGCCTCTCCCCCTCAAGTACCGTGTCCAGCCAGCCTGCA
AGCGGCTCACCCTAGCCACGGTGCCCACCCCCTCCGAGGGCACCAACACCAGCGGGGCGTCCGAGTGTGA
GTCAGTCAGCGACAAGGCTCCCAGCCCTGCCACCCTGCCAGCCACCTCCTCCTCCCTGCCCAGCCCAGCC
ACCCCATCCCATGGCTCTCCCAGTTCCCATGGGCCTCCAGCCACCCACCCTACCTCCCCCACTCCCCCTT
CGACAGCCAGTGGGGCCACCACAGCTGCCAACGGGGGTAGCTTGAACTGCCTGCAGACACCATCCTCCAC
CAGCAGGGGGCGCAAGATGACTGTCAACGGCGCTCCCGTGCCCCCCTTAACT


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC202490 protein sequence
Red=Cloning site Green=Tags(s)

MHRTTRIKITELNPHLMCALCGGYFIDATTIVECLHSFCKTCIVRYLETNKYCPMCDVQVHKTRPLLSIR
SDKTLQDIVYKLVPGLFKDEMKRRRDFYAAYPLTEVPNGSNEDRGEVLEQEKGALSDDEIVSLSIEFYEG
ARDRDEKKGPLENGDGDKEKTGVRFLRCPAAMTVMHLAKFLRNKMDVPSKYKVEVLYEDEPLKEYYTLMD
IAYIYPWRRNGPLPLKYRVQPACKRLTLATVPTPSEGTNTSGASECESVSDKAPSPATLPATSSSLPSPA
TPSHGSPSSHGPPATHPTSPTPPSTASGATTAANGGSLNCLQTPSSTSRGRKMTVNGAPVPPLT

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_007144
ORF Size 1032 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_007144.3
RefSeq Size 2622 bp
RefSeq ORF 1035 bp
Locus ID 7703
UniProt ID P35227
Cytogenetics 17q12
Domains RING
Protein Families Transcription Factors
MW 37.8 kDa
Summary The protein encoded by this gene contains a RING finger motif and is similar to the polycomb group (PcG) gene products. PcG gene products form complexes via protein-protein interaction and maintain the transcription repression of genes involved in embryogenesis, cell cycles, and tumorigenesis. This protein was shown to act as a negative regulator of transcription and has tumor suppressor activity. The expression of this gene was detected in various tumor cells, but is limited in neural organs in normal tissues. Knockout studies in mice suggested that this protein may negatively regulate the expression of different cytokines, chemokines, and chemokine receptors, and thus plays an important role in lymphocyte differentiation and migration, as well as in immune responses. [provided by RefSeq, Jul 2008]
Write Your Own Review
You're reviewing:Mel18 (PCGF2) (NM_007144) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC202490L1 Lenti ORF clone of Human polycomb group ring finger 2 (PCGF2), Myc-DDK-tagged 10 ug
$757.00
RC202490L2 Lenti ORF clone of Human polycomb group ring finger 2 (PCGF2), mGFP tagged 10 ug
$757.00
RC202490L3 Lenti ORF clone of Human polycomb group ring finger 2 (PCGF2), Myc-DDK-tagged 10 ug
$757.00
RC202490L4 Lenti ORF clone of Human polycomb group ring finger 2 (PCGF2), mGFP tagged 10 ug
$757.00
RG202490 PCGF2 (tGFP-tagged) - Human polycomb group ring finger 2 (PCGF2) 10 ug
$657.00
SC115690 PCGF2 (untagged)-Human polycomb group ring finger 2 (PCGF2) 10 ug
$457.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.