DUSP12 (NM_007240) Human Tagged ORF Clone

SKU
RC202411
DUSP12 (Myc-DDK-tagged)-Human dual specificity phosphatase 12 (DUSP12)
  • TrueORF Gold

    Protein expression verified by Western blot, fully sequenced and in stock

    Click here to learn more.

$457.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol DUSP12
Synonyms DUSP1; YVH1
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC202411 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGTTGGAGGCTCCGGGCCCGAGTGATGGCTGCGAGCTCAGCAACCCCAGCGCCAGCAGAGTCAGCTGTG
CCGGGCAGATGCTGGAAGTGCAGCCAGGATTGTATTTCGGTGGGGCCGCGGCCGTCGCGGAGCCAGATCA
CCTGAGGGAAGCGGGCATCACGGCCGTGCTAACAGTGGACTCGGAGGAGCCCAGCTTCAAGGCGGGGCCT
GGGGTCGAGGATCTATGGCGCCTCTTCGTGCCAGCGCTGGACAAACCCGAGACGGACCTACTCAGCCATC
TGGACCGGTGCGTGGCCTTCATCGGTCAGGCCCGCGCTGAGGGCCGTGCGGTGTTGGTGCACTGTCATGC
AGGAGTCAGTCGAAGTGTGGCCATAATAACTGCTTTTCTCATGAAGACTGACCAACTTCCCTTTGAAAAA
GCCTATGAAAAGCTCCAGATTCTCAAACCAGAGGCTAAGATGAATGAGGGGTTTGAGTGGCAACTGAAAT
TATACCAGGCAATGGGATATGAAGTGGATACCTCTAGTGCAATTTATAAGCAATATCGTTTACAAAAGGT
TACAGAGAAGTATCCAGAATTGCAGAATTTACCTCAAGAACTCTTTGCTGTTGACCCAACTACCGTTTCA
CAAGGATTGAAAGATGAGGTTCTCTACAAGTGTAGAAAGTGCAGGCGATCATTATTTCGAAGTTCTAGTA
TTCTGGATCACCGTGAAGGAAGTGGACCTATAGCCTTTGCCCACAAGAGAATGACACCATCTTCCATGCT
TACCACAGGGAGGCAAGCTCAATGTACATCTTATTTCATTGAACCTGTACAGTGGATGGAATCTGCTTTG
TTGGGAGTGATGGATGGACAGCTTCTTTGCCCAAAATGCAGTGCCAAGTTGGGTTCCTTCAACTGGTATG
GTGAACAGTGCTCTTGTGGTAGGTGGATAACACCTGCTTTTCAAATACATAAGAATAGAGTGGATGAAAT
GAAAATATTGCCTGTTTTGGGATCACAAACAGGAAAAATA


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC202411 protein sequence
Red=Cloning site Green=Tags(s)

MLEAPGPSDGCELSNPSASRVSCAGQMLEVQPGLYFGGAAAVAEPDHLREAGITAVLTVDSEEPSFKAGP
GVEDLWRLFVPALDKPETDLLSHLDRCVAFIGQARAEGRAVLVHCHAGVSRSVAIITAFLMKTDQLPFEK
AYEKLQILKPEAKMNEGFEWQLKLYQAMGYEVDTSSAIYKQYRLQKVTEKYPELQNLPQELFAVDPTTVS
QGLKDEVLYKCRKCRRSLFRSSSILDHREGSGPIAFAHKRMTPSSMLTTGRQAQCTSYFIEPVQWMESAL
LGVMDGQLLCPKCSAKLGSFNWYGEQCSCGRWITPAFQIHKNRVDEMKILPVLGSQTGKI

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_007240
ORF Size 1020 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_007240.1, NP_009171.1
RefSeq Size 1271 bp
RefSeq ORF 1023 bp
Locus ID 11266
UniProt ID Q9UNI6
Cytogenetics 1q23.3
Domains DSPc
Protein Families Druggable Genome, Phosphatase
MW 37.7 kDa
Summary The protein encoded by this gene is a member of the dual specificity protein phosphatase subfamily. These phosphatases inactivate their target kinases by dephosphorylating both the phosphoserine/threonine and phosphotyrosine residues. They negatively regulate members of the mitogen-activated protein (MAP) kinase superfamily (MAPK/ERK, SAPK/JNK, p38), which is associated with cellular proliferation and differentiation. Different members of the family of dual specificity phosphatases show distinct substrate specificities for various MAP kinases, different tissue distribution and subcellular localization, and different modes of inducibility of their expression by extracellular stimuli. This gene product is the human ortholog of the Saccharomyces cerevisiae YVH1 protein tyrosine phosphatase. It is localized predominantly in the nucleus, and is novel in that it contains, and is regulated by a zinc finger domain. [provided by RefSeq, Jul 2008]
Write Your Own Review
You're reviewing:DUSP12 (NM_007240) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC202411L1 Lenti ORF clone of Human dual specificity phosphatase 12 (DUSP12), Myc-DDK-tagged 10 ug
$757.00
RC202411L2 Lenti ORF clone of Human dual specificity phosphatase 12 (DUSP12), mGFP tagged 10 ug
$757.00
RC202411L3 Lenti ORF clone of Human dual specificity phosphatase 12 (DUSP12), Myc-DDK-tagged 10 ug
$757.00
RC202411L4 Lenti ORF clone of Human dual specificity phosphatase 12 (DUSP12), mGFP tagged 10 ug
$757.00
RG202411 DUSP12 (tGFP-tagged) - Human dual specificity phosphatase 12 (DUSP12) 10 ug
$489.00 MSRP $657.00 MSRP $657.00
SC319165 DUSP12 (untagged)-Human dual specificity phosphatase 12 (DUSP12) 10 ug
$457.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.